Property Summary

NCBI Gene PubMed Count 47
PubMed Score 105.46
PubTator Score 99.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 5.3e-03
osteosarcoma -3.431 5.0e-11
glioblastoma 1.100 2.1e-02
intraductal papillary-mucinous carcinoma... 1.900 3.9e-02
adult high grade glioma 1.100 3.8e-04
ovarian cancer 1.900 1.9e-04

Gene RIF (39)

PMID Text
26997449 WISP3 harbored not only frameshift mutation but also mutational intratumoral heterogeneity and loss of expression, which together might play a role in tumorigenesis of GC and CRC with MSI-H by inhibiting tumor suppressor functions of WISP3.
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26493744 WISP3 variant leads to the diagnosis of SEDT-PA.
25988854 Novel and recurrent mutations in WISP3 and an atypical phenotype have been described in Indian families with progressive pseudorheumatoid dysplasia.
25794430 Novel C223G and C252X mutations in exon 4 of the WISP3 gene are responsible for progressive pseudorheumatoid dysplasia in Chinese patients.
25738435 A novel mutation c.667T>G (p.Cys223Gly) and the c.857C>G (p.Ser286*) mutation were detected in three Chinese patients with PPD.
25553839 This study identified 3 different WISP3 mutations in 2 unrelated Chinese families with spondyloepiphyseal dysplasia tarda with progressive arthropathy.
25400723 Suggest WISP3-Wnt/beta-catenin axis may have role in regulating gastric cancer cell proliferation and metastasis.
23424195 Results are indicative of an operational WISP3-IGF1 regulatory loop whereby WISP3 preserves cartilage integrity by restricting IGF1-mediated hypertrophic changes in chondrocytes, at least partly, upon interaction with IGF1.
23226100 These results reveal a novel function of the matricellular protein CCN6 and establish a mechanistic link between CCN6 and TbetaRIII in maintaining acinar organization in the breast.
22987568 A report on 11 different homozygous mutations and one instance of compound heterozygosity in the WISP3 gene in patients with progressive pseudorheumatoid dysplasia.
22805309 The data presented in this study reveal that CCN6 downregulation disrupts acinar morphogenesis and promotes invasion of mammary epithelial cells
22791401 Mutation analysis of WISP3 allowed the confirmation of the diagnosis in 63 out of 64 typical cases of progressive pseudorheumatoid dysplasia.
22685593 Results indicate that WNT1-inducible signaling pathway protein 3 (WISP3) mutations are associated with progressive pseudorheumatoid dysplasia (PPD).
22294415 CCN6 was highly expressed in end-stage osteoarthritic cartilage, suggesting a role in cartilage homeostasis. CCN6-induced repression of ADAMTS-5 and regulation of MMP-10 expression suggest complex roles for CCN6 in cartilage biology.
21993478 The mutations of the WISP3 gene in Progressive pseudorheumatoid dysplasia are located in the range of exon 2 to exon 5.
21921419 demonstrated that CCN6 induced the proliferation of lung fibroblasts by binding to integrin beta1, leading to the phosphorylation of FAK(Y397).
21628462 KLK12 may indirectly regulate the bioavailability and activity of several growth factors through processing of their CCN binding partners
21528827 Homozygous recurring mutation in WISP3 causing progressive pseudorheumatoid arthropathy.
21525039 Data define a pathway in which CCN6 attenuates IGF-1 signaling to decrease ZEB1 expression and invasion in breast cancer.
21391218 our results indicate that CCN6 enhances the migration of chondrosarcoma cells by increasing ICAM-1 expression
21159247 The expressions of Cyr61 and/or WISP-3 may be important biological markers in reflecting the progression, biological behaviors, metastatic potential and prognosis of NSCLC.
20403915 Observational study of gene-disease association. (HuGE Navigator)
20395207 CCN6 (WISP3) blockade activates growth factor-independent survival and resistance to anoikis in human mammary epithelial cells
20372786 WISPs may play important but contrasting roles in colorectal cancer with WISP-1 appearing to act as a factor stimulating aggressiveness, WISP-2 as a tumour suppressor and WISP-3 having no definable beneficial or detrimental role
20014943 WISP3 and RhoC genes expression status defines a molecular signature of inflammatory breast cancer (IBC).
19453261 Observational study of gene-disease association. (HuGE Navigator)
19064006 novel G46X and C114Y mutations in exon 3 in WISP3 gene are responsible for PPD in Chinese patients
18321996 These results lead to a new hypothesis that Snail and ZEB1 are downstream of CCN6 and play a critical role in CCN6-mediated regulation of E-cadherin in breast cancer.
17483925 Results show a compound heterozygous mutation of WISP3 and a series of cellular and molecular changes disturbing the endochondral ossification in this PPD patient.
17406949 WISP-3 showed no statistically significant difference between groups.
17363178 Mutant WISP3 triggers the phenotype shift of articular chondrocytes by promoting sensitivity to IGF1 hypothesis of osteochondrodysplasias.
17286957 WISP3 regulates the accumulation of cellular reactive oxygen species, and mutations in WISP3 or loss of expression of WISP3 compromise this function.
16480948 WISP-3 may also promote superoxide dismutase expression and activity in chondrocytes
16457688 stable inhibition of CCN6 expression in human mammary epithelial cells induces epithelial-mesenchymal transition, promotes anchorage-independent growth, motility and invasiveness, and sensitizes mammary epithelial cells to the growth effects of IGF-1
15650268 WISP transcripts may have a role in the development of human hepatocellular carcinoma
15601861 the WISP3 gene is essential to skeletal growth or homeostasis in humans but not in mice
15517620 WISP3 gene expression is higher in rheumatoid arthritis synovium and fibroblast-like synoviocytes compared with osteoarthritis and normal synovial tissue and is further induced by proinflammatory cytokines in vitro.
12082632 WISP3 acts as a tumor suppressor gene in the breast. Loss of WISP3 expression contributes to the phenotype of IBC by regulating tumor cell growth, invasion and angiogenesis.

AA Sequence

MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGVSLVRD      1 - 70
GCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPL     71 - 140
FSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCL    141 - 210
VQATKWTPCSRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKF    211 - 280
VFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSE    281 - 350
LKIL                                                                      351 - 354
//

Text Mined References (47)

PMID Year Title
26997449 2016 Frameshift mutation of WISP3 gene and its regional heterogeneity in gastric and colorectal cancers.
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26493744 2016 An argument for early genomic sequencing in atypical cases: a WISP3 variant leads to diagnosis of progressive pseudorheumatoid arthropathy of childhood.
25988854 2015 Novel and recurrent mutations in WISP3 and an atypical phenotype.
25794430 2015 A novel compound WISP3 mutation in a Chinese family with progressive pseudorheumatoid dysplasia.
25738435 2015 Identification of a mutation in the WISP3 gene in three unrelated families with progressive pseudorheumatoid dysplasia.
25553839 2015 Novel WISP3 mutations causing spondyloepiphyseal dysplasia tarda with progressive arthropathy in two unrelated Chinese families.
25400723 2014 Silencing of WISP3 suppresses gastric cancer cell proliferation and metastasis and inhibits Wnt/?-catenin signaling.
23424195 2013 WISP3-IGF1 interaction regulates chondrocyte hypertrophy.
23226100 2012 CCN6 knockdown disrupts acinar organization of breast cells in three-dimensional cultures through up-regulation of type III TGF-? receptor.
22987568 2012 Analysis of the WISP3 gene in Indian families with progressive pseudorheumatoid dysplasia.
22805309 2012 CCN6 modulates BMP signaling via the Smad-independent TAK1/p38 pathway, acting to suppress metastasis of breast cancer.
22791401 2012 The diagnostic challenge of progressive pseudorheumatoid dysplasia (PPRD): a review of clinical features, radiographic features, and WISP3 mutations in 63 affected individuals.
22685593 2012 Novel and recurrent mutations of WISP3 in two Chinese families with progressive pseudorheumatoid dysplasia.
22294415 2012 Dual regulation of metalloproteinase expression in chondrocytes by Wnt-1-inducible signaling pathway protein 3/CCN6.
21993478 2012 Patients with progressive pseudorheumatoid dysplasia: from clinical diagnosis to molecular studies.
21921419 2011 CCN6 as a profibrotic mediator that stimulates the proliferation of lung fibroblasts via the integrin ?1/focal adhesion kinase pathway.
21628462 2011 Kallikrein-related peptidase 12 hydrolyzes matricellular proteins of the CCN family and modifies interactions of CCN1 and CCN5 with growth factors.
21528827 2011 A homozygous recurring mutation in WISP3 causing progressive pseudorheumatoid arthropathy.
21525039 2011 CCN6 (WISP3) decreases ZEB1-mediated EMT and invasion by attenuation of IGF-1 receptor signaling in breast cancer.
21391218 2012 CCN6 enhances ICAM-1 expression and cell motility in human chondrosarcoma cells.
21159247 2010 [Expressions of Cyr61 and WISP-3 in non-small cell lung cancer and its clinical significance].
20403915 2010 Single nucleotide polymorphisms in Wnt signaling and cell death pathway genes and susceptibility to colorectal cancer.
20395207 2010 Blockade of CCN6 (WISP3) activates growth factor-independent survival and resistance to anoikis in human mammary epithelial cells.
20372786 2010 Differential expression of the CCN family member WISP-1, WISP-2 and WISP-3 in human colorectal cancer and the prognostic implications.
20014943 2010 Expression of WISP3 and RhoC genes at mRNA and protein levels in inflammatory and noninflammatory breast cancer in Tunisian patients.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19064006 2009 Identification of novel mutations in WISP3 gene in two unrelated Chinese families with progressive pseudorheumatoid dysplasia.
18321996 2008 Inhibition of CCN6 (Wnt-1-induced signaling protein 3) down-regulates E-cadherin in the breast epithelium through induction of snail and ZEB1.
17483925 2007 Cellular and molecular responses in progressive pseudorheumatoid dysplasia articular cartilage associated with compound heterozygous WISP3 gene mutation.
17406949 2007 Differential expression and prognostic implications of the CCN family members WISP-1, WISP-2, and WISP-3 in human breast cancer.
17363178 2007 Mutant WISP3 triggers the phenotype shift of articular chondrocytes by promoting sensitivity to IGF-1 hypothesis of spondyloepiphyseal dysplasia tarda with progressive arthropathy (SEDT-PA).
17286957 2007 Potential role of WISP3 (CCN6) in regulating the accumulation of reactive oxygen species.
16480948 2006 WISP-3 functions as a ligand and promotes superoxide dismutase activity.
16457688 2005 Inhibition of CCN6 (WISP3) expression promotes neoplastic progression and enhances the effects of insulin-like growth factor-1 on breast epithelial cells.
15650268 2004 Expression of WISPs and of their novel alternative variants in human hepatocellular carcinoma cells.
15601861 2005 WISP3, the gene responsible for the human skeletal disease progressive pseudorheumatoid dysplasia, is not essential for skeletal function in mice.
15517620 2004 Wnt1 inducible signaling pathway protein-3 regulation and microsatellite structure in arthritis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300987 2004 Gene symbol: WISP3. Disease: spondyloepihyseal dysplasia tarda with progressive arthropathy.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12105881 2002 Variant WISPs as targets for gastrointestinal carcinomas.
10471507 1999 Mutations in the CCN gene family member WISP3 cause progressive pseudorheumatoid dysplasia.
9843955 1998 WISP genes are members of the connective tissue growth factor family that are up-regulated in wnt-1-transformed cells and aberrantly expressed in human colon tumors.
7687569 1993 The modular architecture of a new family of growth regulators related to connective tissue growth factor.