Property Summary

NCBI Gene PubMed Count 42
PubMed Score 58.74
PubTator Score 51.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.600 2.1e-44
cutaneous lupus erythematosus -2.300 3.0e-04
limb girdle muscular dystrophy 2I 1.502 6.8e-04
Becker muscular dystrophy 1.098 1.2e-02
acute quadriplegic myopathy 1.067 1.2e-03
Atopic dermatitis -3.200 1.5e-04
non-small cell lung cancer -2.752 2.9e-24
lung cancer -1.500 1.4e-03
breast carcinoma -1.300 3.1e-02
fibroadenoma -3.700 2.0e-04
aldosterone-producing adenoma -1.691 6.9e-03
lung adenocarcinoma -2.600 4.6e-07
ductal carcinoma in situ -2.800 1.1e-03
invasive ductal carcinoma -3.000 3.0e-03

Gene RIF (31)

PMID Text
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26218313 Report opposing effects of CCN2 and CCN5 on fibroblast proliferation and transdifferentiation induced by TGF-beta.
25509878 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia.
25132260 Activation of CCN5 may have the therapeutic potential to kill triple-negative breast cancer.
25089371 Serum WISP2 correlated directly with fatty acid binding protein 4. Serum SFRP5 did not differ between obese (n=32) vs. nonobese (n=25) PCOS women, but reference women had lower SFRP5 (p<5x10(-6) as compared to both PCOS groups).
24931170 WISP2 has a role in regulating tumor cell susceptibility through EMT by inducing the TGF-beta signaling pathway, KLF-4 expression and miR-7 inhibition.
24498388 Loss of WISP2 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype.
24451367 WISP2 exerts dual actions in mesenchymal precursor cells; secreted WISP2 activates canonical WNT and maintains the cells in an undifferentiated state, whereas cytosolic WISP2 regulates adipogenic commitment.
24276150 We demonstrate that the overexpression of CCN5 in lung fibroblasts suppresses the upregulation in the expression of alpha-SMA and collagen induced by CCN2.
23893926 Regulation of invasion by WISP2 may involve the WNT signalling pathway.
23592278 overexpression of FGFBP1 or loss of WISP-2 expression is closely related to the metastasis, invasion and poor prognosis of gallbladder cancer.
23359679 WISP2 regulates preadipocyte commitment and PPARgamma activation by BMP4.
22616691 WISP2 gene expression is regulated both by obesity and by the region between visceral and subcutaneous adipose tissue.
22020939 Studies suggest a novel regulatory pathway exists through which CCN5 exerts its anti-invasive function.
21262769 CCN5 represses expression of genes associated with epithelial-mesenchymal transition (EMT) as well as expression of key components of the transforming growth factor beta (TGF-beta) signaling pathway.
20372786 WISPs may play important but contrasting roles in colorectal cancer with WISP-1 appearing to act as a factor stimulating aggressiveness, WISP-2 as a tumour suppressor and WISP-3 having no definable beneficial or detrimental role
20010302 The CCN5/WISP2 were downregulated in paired comparisons of plexiform neurofibroma and malignant peripheral nerve sheath tumor.
19453261 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of WNT1 inducible signaling pathway protein 2 (WISP2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18794149 CCN5 mRNA and protein level was almost undetectable in poorly differentiated breast cancers compared with the moderately or well-differentiated samples and its expression inversely correlated with lymph node positivity.
18559502 Loss of CCN5 is associated with gain of oncogenic function of p53 mutants invasiveness in breast cancer
18070926 WISP-2/CCN5 is an important regulator involved in the maintenance of a differentiated phenotype in breast tumor epithelial cells and may play a role in tumor cell invasion and metastasis
17406949 WISP-2 had greater levels of expression in node-positive tumors; higher levels in both moderate and poor prognostic groups compared with the good prognostic group; greater level in both grade 2 and 3 when compared with grade 1.
17383817 Data suggest WISP-2/CCN5 silencing may be a critical event during differentiation and progression of pancreatic adenocarcinoma.
16939222 WISP-2/CCN5 is a novel signaling molecule that critically participates in the mitogenic action of PMA on noninvasive, WISP-2/CCN5-positive breast tumor cells through PKCalpha-dependent, multiple molecular signal transduction pathways.
16525711 Results suggest that WISP-2 could be a reliable independent marker and that down-regulation or loss of the WISP-2 gene may be associated with the development of salivary gland tumors.
16038875 These data demonstrate that the expression of WISP2 is synergistically upregulated in RA synovial fibroblasts by estrogen and WNT pathways, and suggest an involvement in the pathology of the disease.
15798095 regulation of phosphorylation of ER-alpha and EGFR may play critical roles in EGF-induced transcriptional activation of WISP-2 gene in breast tumor cells
14767469 WISP2 was overexpressed in gastrointestinal peptide-independent ACTH-independent macronodular adrenal hyperplasia.
12659671 disruption of WISP-2 signaling by use of antisense oligomers caused a significant reduction in breast tumor cell proliferation
11855747 Overexpression of WISP2 is associated with breast cancer

AA Sequence

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVC      1 - 70
DASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRL     71 - 140
PSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGL    141 - 210
GMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF                                  211 - 250
//

Text Mined References (43)

PMID Year Title
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26218313 2015 CCN2 and CCN5 exerts opposing effect on fibroblast proliferation and transdifferentiation induced by TGF-?.
25509878 [The effects of simulated microgravity on the pattern of gene expression in human bone marrow mesenchymal stem cells under osteogenic differentiation].
25132260 2015 CCN5/WISP-2 promotes growth arrest of triple-negative breast cancer cells through accumulation and trafficking of p27(Kip1) via Skp2 and FOXO3a regulation.
25089371 2015 Roles of circulating WNT-signaling proteins and WNT-inhibitors in human adiposity, insulin resistance, insulin secretion, and inflammation.
24931170 2015 Targeting WNT1-inducible signaling pathway protein 2 alters human breast cancer cell susceptibility to specific lysis through regulation of KLF-4 and miR-7 expression.
24498388 2014 Loss of WISP2/CCN5 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype.
24451367 2014 The Novel Secreted Adipokine WNT1-inducible Signaling Pathway Protein 2 (WISP2) Is a Mesenchymal Cell Activator of Canonical WNT.
24276150 2014 CCN5 overexpression inhibits profibrotic phenotypes via the PI3K/Akt signaling pathway in lung fibroblasts isolated from patients with idiopathic pulmonary fibrosis and in an in vivo model of lung fibrosis.
23893926 A role for WISP2 in colorectal cancer cell invasion and motility.
23592278 2014 A comparative study of clinicopathological significance, FGFBP1, and WISP-2 expression between squamous cell/adenosquamous carcinomas and adenocarcinoma of the gallbladder.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23359679 2013 WISP2 regulates preadipocyte commitment and PPAR? activation by BMP4.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22616691 2012 Functional annotation of the human fat cell secretome.
22020939 2011 Cysteine-rich 61-connective tissue growth factor-nephroblastoma-overexpressed 5 (CCN5)/Wnt-1-induced signaling protein-2 (WISP-2) regulates microRNA-10b via hypoxia-inducible factor-1?-TWIST signaling networks in human breast cancer cells.
21262769 2011 CCN5, a novel transcriptional repressor of the transforming growth factor ? signaling pathway.
20372786 2010 Differential expression of the CCN family member WISP-1, WISP-2 and WISP-3 in human colorectal cancer and the prognostic implications.
20010302 2010 Differential expression of CCN1/CYR61, CCN3/NOV, CCN4/WISP1, and CCN5/WISP2 in neurofibromatosis type 1 tumorigenesis.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18794149 2008 CCN5/WISP-2 expression in breast adenocarcinoma is associated with less frequent progression of the disease and suppresses the invasive phenotypes of tumor cells.
18559502 2008 Gain of oncogenic function of p53 mutants induces invasive phenotypes in human breast cancer cells by silencing CCN5/WISP-2.
18070926 2008 Role of WISP-2/CCN5 in the maintenance of a differentiated and noninvasive phenotype in human breast cancer cells.
17406949 2007 Differential expression and prognostic implications of the CCN family members WISP-1, WISP-2, and WISP-3 in human breast cancer.
17383817 2007 Loss of WISP-2/CCN5 signaling in human pancreatic cancer: a potential mechanism for epithelial-mesenchymal-transition.
16939222 2006 WISP-2/CCN5 is involved as a novel signaling intermediate in phorbol ester-protein kinase Calpha-mediated breast tumor cell proliferation.
16525711 2006 WISP-2 expression in human salivary gland tumors.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16038875 2005 Expression and regulation of WISP2 in rheumatoid arthritic synovium.
15798095 2005 Epidermal growth factor induces WISP-2/CCN5 expression in estrogen receptor-alpha-positive breast tumor cells through multiple molecular cross-talks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14981145 2004 The growth arrest-specific gene CCN5 is deficient in human leiomyomas and inhibits the proliferation and motility of cultured human uterine smooth muscle cells.
14767469 2004 Gene array analysis of macronodular adrenal hyperplasia confirms clinical heterogeneity and identifies several candidate genes as molecular mediators.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12659671 WISP-2 gene in human breast cancer: estrogen and progesterone inducible expression and regulation of tumor cell proliferation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056810 2002 WISP-2 is a secreted protein and can be a marker of estrogen exposure in MCF-7 cells.
11855747 2001 Differential expression of WISP-1 and WISP-2 genes in normal and transformed human breast cell lines.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10358067 1999 Identification and cloning of a connective tissue growth factor-like cDNA from human osteoblasts encoding a novel regulator of osteoblast functions.
9843955 1998 WISP genes are members of the connective tissue growth factor family that are up-regulated in wnt-1-transformed cells and aberrantly expressed in human colon tumors.