Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.57
PubTator Score 9.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 8.2e-07
psoriasis 6685 1.3e-04
ovarian cancer 8491 1.8e-04
medulloblastoma, large-cell 6234 2.7e-04

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.300 1.3e-04
osteosarcoma -2.113 8.2e-07
medulloblastoma, large-cell 1.200 2.7e-04
ovarian cancer 1.600 1.8e-04

Synonym

Accession Q9Y4P8 B3KNC2 Q5MNZ8 Q6FI96 Q75L50 Q96IE4 Q9Y364 WIPI-2
Symbols Atg21
ATG18B
CGI-50
WIPI-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25462558 The specific autophagosomal localization of both WIPI1 and WIPI2 (refered to as WIPI puncta) has been employed to assess autophagy using fluorescence microscopy methods, such as confocal and live-cell video microscopy
25233424 Data suggest WIPI1/WIPI2 co-localize with microtubule-associated light chain 3 and autophagy related proteins 2/14L, participate in biogenesis of phagosomes, autophagy, and mobilization of lipids to/from intracellular droplets. [review-like article]
25233411 Data suggest that WIPI2b directly interacts with dimer of ATG16L1 (autophagy related 16-like 1) and this interaction is linked to production of phosphatidylinositol 3-phosphate in endoplasmic reticulum triggered by autophagosome formation. [REVIEW]
24991767 WIPI-1 and WIPI-2 are functionally required in mediating the PI3P signal at the onset of autophagy in NB4 cells.
24954904 WIPI2b binds the membrane surrounding Salmonella and recruits the Atg12-5-16L1 complex, initiating LC3 conjugation, autophagosomal membrane formation, and engulfment of Salmonella.
21564513 Freeze-fracture replica immunolabelling reveals WD-repeat protein interacting with phosphoinositides 1 and 2 (WIPI-1 and WIPI-2) as membrane components of autophagosomes and the plasma membrane (PM).
20505359 A role for WIPI2 in the progression of omegasomes into autophagosomes, is reported.
20505359 WIPI2 is a phosphatidylinsitol-3-phosphate binding protein required for starvation induced autophagy.

AA Sequence

MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSSVDKLEQIYEC      1 - 70
TDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIH     71 - 140
NIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAF    141 - 210
DASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETV    211 - 280
KEKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAA    281 - 350
DGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYT    351 - 420
DDLGAVGGACLEDEASALRLDEDSEHPPMILRTD                                        421 - 454
//

Text Mined References (29)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25462558 2015 Fluorescence-based imaging of autophagy progression by human WIPI protein detection.
25416956 2014 A proteome-scale map of the human interactome network.
25233424 2014 WIPI ?-propellers at the crossroads of autophagosome and lipid droplet dynamics.
25233411 2014 WIPI2b and Atg16L1: setting the stage for autophagosome formation.
24991767 2014 WIPI-dependent autophagy during neutrophil differentiation of NB4 acute promyelocytic leukemia cells.
24954904 2014 WIPI2 links LC3 conjugation with PI3P, autophagosome formation, and pathogen clearance by recruiting Atg12-5-16L1.
23916833 2013 Inhibition of LRRK2 kinase activity stimulates macroautophagy.
23434374 2013 ZKSCAN3 is a master transcriptional repressor of autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22456507 2012 Dynamic and transient interactions of Atg9 with autophagosomes, but not membrane integration, are required for autophagy.
21575909 2011 A Tecpr1-dependent selective autophagy pathway targets bacterial pathogens.
21564513 2011 Freeze-fracture replica immunolabelling reveals human WIPI-1 and WIPI-2 as membrane proteins of autophagosomes.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20505359 2010 Mammalian Atg18 (WIPI2) localizes to omegasome-anchored phagophores and positively regulates LC3 lipidation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
15602573 2004 WIPI-1alpha (WIPI49), a member of the novel 7-bladed WIPI protein family, is aberrantly expressed in human cancer and is linked to starvation-induced autophagy.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
9847074 1998 Toward a complete human genome sequence.