Property Summary

NCBI Gene PubMed Count 96
PubMed Score 130.26
PubTator Score 136.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -4.600 3.3e-03
oligodendroglioma -3.800 4.1e-02
psoriasis -4.400 3.4e-16
cutaneous lupus erythematosus -3.200 5.8e-04
glioblastoma -5.200 1.4e-05
medulloblastoma -5.800 1.1e-08
medulloblastoma, large-cell -4.000 1.4e-02
primitive neuroectodermal tumor -4.600 6.8e-05
Atopic dermatitis -4.000 1.2e-04
non-small cell lung cancer -4.267 9.6e-16
colon cancer -1.300 6.3e-04
interstitial cystitis -5.000 4.0e-05
lung adenocarcinoma -5.400 2.4e-18
adult high grade glioma -5.000 3.1e-05
pilocytic astrocytoma -2.200 1.9e-02
posterior fossa group B ependymoma -2.500 7.9e-03
subependymal giant cell astrocytoma -4.349 9.6e-04
Breast cancer -5.200 7.8e-49
lung carcinoma -5.700 2.6e-49
breast carcinoma -3.500 1.9e-22
invasive ductal carcinoma -1.300 3.6e-02
pituitary cancer -1.900 1.3e-02

 MGI Phenotype (2)

Gene RIF (83)

PMID Text
26405993 WIF-1 down-regulation may promote tumor cells invasion and metastasis in salivary gland adenoid cystic carcinoma.
26352791 Results provide evidence that WIF1 is frequently methylated in oral squamous cell carcinoma (OSCC), but not in oral submucous fibrosis tissues, which results in reduced expression. This epigenetic biomarker can be used for the early detection of OSCC.
26342861 Data show that the WIF domain of Wnt Inhibitory Factor 1 (WIF1) is bound by C-terminal domains of Wnt proteins Wnt5a and Wnt7a at two sites.
25918249 WIF1 has a role in breast neoplasms: its inhibition significantly relieves the cancer stem cell-limiting effects of dietary compound isoliquiritigenin
25772239 Loss of WIF1 enhances the migratory potential of glioblastoma through WNT5A that activates the WNT/Ca(2+) pathway and MALAT1.
25681036 miR-603 regulates glioma development via Wnt-beta-cateninn signaling pathway and its WIF1 and CTNNBIP1 targets.
25487617 Further evaluation of the methylation of DACH1, DKK1, and WIF1 in a clinical patient group confirmed the frequent methylation of WIF1 and intermediate or low frequency of methylation of DACH1 or DKK1, respectively.
25142166 Altered expression of genes associated with telomere maintenance and cell function of human vascular endothelial cell at elevated temperature.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25025467 detection of methylated Wif-1 in either S or U has a higher performance accuracy compared to guaiac FOBT for advanced colorectal neoplasia screening
24949429 Coexpression of SFRP1 and WIF1, rather than SFRP1 or WIF1 alone, could be used, together with low TNM stage, as a prognostic predictor of favorable outcomes in CRC.
24853424 WIF1 downregulation is a frequent event in salivary gland carcinoma ex-pleomorphic adenoma.
24833087 WIF-1 is frequently methylated and that Wnt5a acts as a tumor suppressor gene in colorectal carcinoma.
24755523 genetic alterations of beta-catenin and epigenetics-related Wif-1 promoter hypermethylation may be important mechanisms underlying adrenocortical tumor formation
24755295 MicroRNA-181a promotes tumor growth and liver metastasis in colorectal cancer by targeting the tumor suppressor WIF-1.
24561119 WIF-1 is downregulated and functions as a tumor suppressor by antagonizing Wnt/beta-catenin signaling in neuroblastoma.
24289328 Promoter methylation of WIF1, PENK and NPY is associated with colorectal adenocarcinoma (CRC) diagnosis and can be used to CRC from other cancers.
24131586 melanocytes express WIF-1 constitutively in vivo and in vitro and that WIF-1 promotes melanogenesis in normal human melanocytes.
24118380 HOTAIR directly decreased WIF-1 expression by promoting its histone H3K27 methylation in the promoter region and then activated the Wnt/beta-catenin signaling pathway.
23939044 The miR-29 family (miR-29a, -29b, and -29c) suppresses the Wnt signaling pathway through demethylation of WIF-1 in non-small-cell lung cancer.
23746174 Significantly higher methylation was observed in genes NTKR1, GATA4 and WIF1 in the ovarian cancer group compared with the control group.
23686431 Wif1 methylation showed an association with unfavorable prognosis of adenocarcinoma (AC) patients with EGFR mutation.
23417837 Loss of WIF-1 expression due to methylation is related to aggressiveness of sporadic breast cancer.
23358094 WIF1 is a marker of interfollicular keratinocyte stem cells and inhibits their cell cycle progression even with Wnt3 signaling.
23328978 WIF1 expression is downregulated by promoter methylation and is an important mechanism of aberrant WNT/beta-catenin pathway activation in astrocytoma pathogenesis
23316316 These in vivo data support the involvement of Wnt signaling in the development of aortic stenosis and suggest that circulating Wnt modulators such as WIF1 should be further investigated as risk markers in larger aortic stenosis populations.
23193918 Epigenetic inactivation of Wnt inhibitory factor-1 is associated with esophageal squamous cell carcinoma.
22986341 A Wnt-binding site of the WIF-domain of WIF1 was localized. Substitution of some residues of WIF resulted in an increased affinity for Wnt5a, but decreased affinity for Wnt3a, suggesting that these residues may define the specificity of WIF for Wnts.
22951732 It was shown that WIF-1 downregulation is involved in melasma development due to the stimulation of melanogenesis and melanosome transfer through upregulation of the canonical and the noncanonical Wnt signaling pathway.
22951645 study concludes that the WIF domain is responsible for the divergence between Drosophila Shf and human Wif-1, channeling the recognition either toward Hh or Wg signal, whereas the EGF repeats give the protein the ability to interact with glypicans
22901505 This study demonistrated that Wnt inhibitory factor-1 regulates glioblastoma cell cycle and proliferation.
22333550 The methylation of WIF-1 gene promoter and beta-catenin may be involved in the abnormal activation of Wnt/beta-catenin signal in acute leukemia.
22315090 Promoter methylation status analysis of hereditary breast tumors revealed high methylation frequencies for the three genes (67% RASSF1A, 80% SLIT2, and 72% WIF1).
22002305 Loss of WIF1 is associated with cervical cancer.
21928342 Data show that Wif-1 can interfere with CTGF-dependent induction of gene expression in primary murine chondrocytes, and indicate that Wif-1 may be a multifunctional modulator of signalling pathways in the cartilage compartment.
21873353 WIF1 is a frequent target for epigenetic silencing in squamous cell carcinoma of the cervix.
21819494 Occurrence of WIF1 genes methylation associated with nodal status and tumor stage. findings indicate WIF1 frequently aberrantly methylated.
21743455 The six-domain WIF-1 crystal structure shows that epidermal growth factor-like domains (EGFs I-V) are wrapped back, interfacing with the WIF-1 domain at EGF III.
21642372 Loss of WIF1 is associated with glioblastoma.
21052890 Down-regulation of WIF-1 mRNA expression is associated with hepatocellular carcinoma.
20874008 Data show that the WIF-1 promoter was methylated in 89.7% of tumors, whereas all normal mucosa were unmethylated.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20811686 This study suggests that a cause of catenin delocalization in oral cancer could be due to WNT pathway activation, by epigenetic alterations of SFRP-1, SFRP-2, SFRP-4, SFRP-5, WIF-1, DKK-3 genes
20697356 Transient knockdown or somatic knockout of c-Myc in DLD-1 failed to restore WIF-1 expression suggesting that c-Myc is involved in initiating rather than maintaining WIF-1 epigenetic silencing
20596629 WIF1 promoter methylation is a common event in mesothelioma.
20573255 Blocking Wnt signaling in PCa by WIF1 may represent a novel strategy in the future to reduce metastatic disease burden in PCa patients
20376066 study suggest a shift away from canonical Wnt signaling toward noncanonical pathways driven by interactions between Wnt-5a and its cognate receptors in psoriasis, accompanied by impaired homeostatic inhibition of Wnt signaling by WIF-1 and dickkopf
20197388 WIF-1 exerts potent antiosteosarcoma effect in vivo in mouse models. Therefore, the reexpression of WIF-1 in WIF-1-deficient osteosarcoma represents a potential novel treatment and preventive strategy.
20119713 WIF-1 silencing as a result of its promoter hypermethylation may be a frequent event in hepatocellular carcinoma.
19926868 Observational study of gene-disease association. (HuGE Navigator)
19887605 the WIF-1 is downregulated by promoter methylation and functions as a tumor suppressor gene by inducing apoptosis in human renal cell carcinoma cells.
19885602 procaine and procainamide reactivate WIF-1 in lung cancer cells and downregulate the Wnt canonical pathway
19787276 hypermethylation of the p16 and Wif-1 genes has potential as biomarkers that may be used to predict the prognosis of stage IA NSCLC.
19773381 Tumor-specific methylation of APC, MGMT, RASSF2A, and Wif-1 genes might be a valuable biomarker in plasma for the early detection of colorectal cancer.
19690140 Wnt antagonist WIF1 inhibits Wnt signaling and exerts potent antitumor activity by increasing the apoptosis rate in tumor cells and by impairing tumor vascularization
19570204 Wnt antagonist genes WIF1 and DKK3 show a very similar frequency of promoter methylation in human breast cancer, but only DKK3 methylation proves as a novel prognostic marker
19528461 Promoter methylation of Wnt inhibitory factor-1 is associated with lung cancer.
19496188 Data suggest that aberrant promoter methylation and decreased expression of DKK-3 and WIF-1 may be an important mechanism in hepatocellular carcinoma, and may be useful for early diagnosis and therapy of HCC.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19307728 analyzed 5 osteosarcoma cell lines in a high-throughput screen for epigenetically silenced tumor suppressor genes and identified Wnt inhibitory factor 1 (WIF1) as a candidate tumor suppressor gene
19174556 Mechanisms of WIF1-induced G(1) arrest include (a) SKP2 down-regulation leading to p27/Kip1 accumulation and (b) c-myc down-regulation releasing p21/WAF1 transcription.
19085002 WIF-1 promoter region MSP might be used as an adjuvant tool to complement cytologic examination for the diagnosis of NSCLC-related malignant pleural effusion.
19054571 Observational study of gene-disease association. (HuGE Navigator)
18701434 Using silencing RNA approaches, we confirmed that downregulation of Sp1 resulted in an increased expression of WIF1 and decreased methylation of WIF1 promoter
18256869 The results suggest a role of the WIF domain as a palmitoyl binding domain required for WIF-1 binding to palmitoylated Wnt and signaling inhibition.
18093228 WIF1 was among the genes differentially expressed in an in vivo-in vivo comparison between unfused and prematurely fused calvarial tissue.
18079202 WIF1 may be a tumor suppressor, specifically in nonfunctioning pituitary tumors, and that the Wnt pathways are important in pituitary tumorigenesis.
18005197 Silencing of WIF-1 through promoter hypermethylation is an early and common event in the carcinogenesis of Barrett's esophagus.
17384664 Thus, WIF1 functions as a tumor suppressor for both NPC and ESCC through suppressing the Wnt-signaling pathway, but is frequently silenced by epigenetic mechanism in a tumor-specific way.
17171686 WIF1 is a recurrent target in human salivary gland oncogenesis and that downregulation of WIF1 plays a role in the development and/or progression of pleomorphic adenomas.
17094650 Modification of the Wnt-signaling pathway are often associated with development of tumor and may play a significant role in carcinogenesis [review]
17012225 Valproic acid causes a change in acetylation of this gene.
16609023 The methylation level of WIF-1 was significantly higher and mRNA level wassignificantly lower in bladder tumor than in bladder mucosa.
16525492 The Wif-1 methylation was the only independent factor negatively impacting on disease-free survival.
16516163 Taken together, our studies suggest that WIF-1 silencing due to its promoter hypermethylation is an important mechanism underlying the constitutively activated Wnt signaling in mesothelioma.
16476441 WIF domains may have a role as a recognition motif of Wnt and Drosophila hedgehog proteins that are activated by palmitoylation.
16428476 Epigenetic inactivation of Wnt inhibitory factor-1 is associated with bladder cancer through aberrant canonical Wnt/beta-catenin signaling pat
16427602 aberrant Wnt signaling is a common event in NPC carcinogenesis linked with WIF-1 silencing
16007117 WIF-1 silencing due to promoter hypermethylation is an important mechanism underlying aberrant activation of the Wnt signaling pathway in carcinogenesis of the digestive organs
15735743 results provide evidence for the involvement of the Wnt/beta-catenin pathway in the pathogenesis of acute myeloid leukemia
15389810 Wnt signaling is involved in Akt activation in prostate cancer cells. Our data also indicate the possibility that Wnt and its signaling pathway can be therapeutic targets for PTEN-mutated advanced prostate carcinoma.
15377999 novel mechanism of Wnt pathway regulation whereby activation of Rac1 amplifies signaling activity of stabilized/mutated beta-catenin by promoting accumulation in nucleus, and synergizing with beta-catenin to augment TCF/LEF-dependent gene transcription
15351726 the methylation-status of the CpG island within the functional WIF-1 promoter region is an important key in Wnt activation in human cancer

AA Sequence

MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDF      1 - 70
RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPC     71 - 140
LGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE    141 - 210
KALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQ    211 - 280
PCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALR    281 - 350
PAGAQLRQHTPSLKKAEERRDPPESNYIW                                             351 - 379
//

Text Mined References (96)

PMID Year Title
26405993 2015 Aberrant Wnt-1/beta-catenin signaling and WIF-1 deficiency are important events which promote tumor cell invasion and metastasis in salivary gland adenoid cystic carcinoma.
26352791 2015 Expression and promoter methylation of Wnt inhibitory factor-1 in the development of oral submucous fibrosis.
26342861 2015 Wnts grasp the WIF domain of Wnt Inhibitory Factor 1 at two distinct binding sites.
25918249 2015 Dietary compound isoliquiritigenin prevents mammary carcinogenesis by inhibiting breast cancer stem cells through WIF1 demethylation.
25772239 2016 WIF1 re-expression in glioblastoma inhibits migration through attenuation of non-canonical WNT signaling by downregulating the lncRNA MALAT1.
25681036 2015 miR-603 promotes glioma cell growth via Wnt/?-catenin pathway by inhibiting WIF1 and CTNNBIP1.
25487617 2015 The negative regulators of Wnt pathway-DACH1, DKK1, and WIF1 are methylated in oral and oropharyngeal cancer and WIF1 methylation predicts shorter survival.
25416956 2014 A proteome-scale map of the human interactome network.
25142166 2014 Altered expression of genes associated with telomere maintenance and cell function of human vascular endothelial cell at elevated temperature.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25025467 2014 The detection of the methylated Wif-1 gene is more accurate than a fecal occult blood test for colorectal cancer screening.
24949429 2014 Coexpression of SFRP1 and WIF1 as a prognostic predictor of favorable outcomes in patients with colorectal carcinoma.
24853424 2014 Wnt inhibitory factor 1 suppresses cancer stemness and induces cellular senescence.
24833087 2014 Downregulation of WIF-1 and Wnt5a in patients with colorectal carcinoma: clinical significance.
24755523 2014 Extracellular activation of Wnt signaling through epigenetic dysregulation of Wnt inhibitory factor-1 (Wif-1) is associated with pathogenesis of adrenocortical tumor.
24755295 2014 MicroRNA-181a promotes tumor growth and liver metastasis in colorectal cancer by targeting the tumor suppressor WIF-1.
24561119 2014 Wnt inhibitory factor-1 functions as a tumor suppressor through modulating Wnt/?-catenin signaling in neuroblastoma.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24289328 2013 Aberrant methylation of NPY, PENK, and WIF1 as a promising marker for blood-based diagnosis of colorectal cancer.
24131586 2014 Wnt inhibitory factor (WIF)-1 promotes melanogenesis in normal human melanocytes.
24118380 2013 HOTAIR, a prognostic factor in esophageal squamous cell carcinoma, inhibits WIF-1 expression and activates Wnt pathway.
23939044 2013 Suppression of Wnt signaling by the miR-29 family is mediated by demethylation of WIF-1 in non-small-cell lung cancer.
23746174 2013 Promoter methylation of GATA4, WIF1, NTRK1 and other selected tumour suppressor genes in ovarian cancer.
23686431 2013 Wif1 hypermethylation as unfavorable prognosis of non-small cell lung cancers with EGFR mutation.
23417837 2013 Loss of WIF-1 and Wnt5a expression is related to aggressiveness of sporadic breast cancer in Tunisian patients.
23358094 2013 WIF1 is expressed by stem cells of the human interfollicular epidermis and acts to suppress keratinocyte proliferation.
23328978 2013 Promoter methylation of WNT inhibitory factor-1 and expression pattern of WNT/?-catenin pathway in human astrocytoma: pathologic and prognostic correlations.
23316316 2012 Secreted Wnt modulators in symptomatic aortic stenosis.
23193918 2012 Epigenetic inactivation of Wnt inhibitory factor-1 in human esophageal squamous cell carcinoma.
22986341 2012 Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1.
22951732 2013 Reduced WIF-1 expression stimulates skin hyperpigmentation in patients with melasma.
22951645 2012 The WIF domain of the human and Drosophila Wif-1 secreted factors confers specificity for Wnt or Hedgehog.
22901505 2012 Wnt inhibitory factor-1 regulates glioblastoma cell cycle and proliferation.
22504421 2012 Common variants at 12q14 and 12q24 are associated with hippocampal volume.
22333550 2011 [Study of WIF-1 promoter methylation with expressions of ?-catenin in acute leukemia].
22315090 2013 Silencing of tumor suppressor genes RASSF1A, SLIT2, and WIF1 by promoter hypermethylation in hereditary breast cancer.
22002305 2012 Wnt inhibitory factor 1 induces apoptosis and inhibits cervical cancer growth, invasion and angiogenesis in vivo.
21928342 2012 The Wnt antagonist Wif-1 interacts with CTGF and inhibits CTGF activity.
21873353 2011 WIF1 is a frequent target for epigenetic silencing in squamous cell carcinoma of the cervix.
21819494 2011 Hypermethylation of RUNX3 but not WIF1 gene and its association with stage and nodal status of tongue cancers.
21743455 2011 Modular mechanism of Wnt signaling inhibition by Wnt inhibitory factor 1.
21642372 2011 The Wnt inhibitory factor 1 (WIF1) is targeted in glioblastoma and has a tumor suppressing function potentially by induction of senescence.
21052890 2011 Prognostic value of Wnt inhibitory factor-1 expression in hepatocellular carcinoma that is independent of gene methylation.
20874008 2010 Epigenetic alteration of the Wnt inhibitory factor-1 promoter is common and occurs in advanced stage of Tunisian nasopharyngeal carcinoma.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20811686 2010 WNT pathway in oral cancer: epigenetic inactivation of WNT-inhibitors.
20697356 2010 Transcriptional regulation of Wnt inhibitory factor-1 by Miz-1/c-Myc.
20596629 2010 Aberrant promoter methylation of WIF-1 and SFRP1, 2, 4 genes in mesothelioma.
20573255 2010 The Wnt inhibitory factor 1 restoration in prostate cancer cells was associated with reduced tumor growth, decreased capacity of cell migration and invasion and a reversal of epithelial to mesenchymal transition.
20421722 2010 Epigenetic regulation of Wnt signaling pathway in urological cancer.
20395289 2010 Patterns of DNA methylation in individual colonic crypts reveal aging and cancer-related field defects in the morphologically normal mucosa.
20376066 2010 Evidence for altered Wnt signaling in psoriatic skin.
20364027 2010 Methylation of cyclin-dependent kinase inhibitors, XAF1, JUNB, CDH13 and soluble Wnt inhibitors in essential thrombocythaemia.
20334650 2010 Expression and aberrant promoter methylation of Wnt inhibitory factor-1 in human astrocytomas.
20197388 2010 Wnt inhibitory factor 1 decreases tumorigenesis and metastasis in osteosarcoma.
20119713 2010 Epigenetic silencing of WIF-1 in hepatocellular carcinomas.
20066439 2010 Clinical characterization of individuals with deletions of genes in holoprosencephaly pathways by aCGH refines the phenotypic spectrum of HPE.
19926868 2010 A role for Wnt signaling genes in the pathogenesis of impaired lung function in asthma.
19887605 2009 Functional significance of Wnt inhibitory factor-1 gene in kidney cancer.
19885602 2009 Procaine and procainamide inhibit the Wnt canonical pathway by promoter demethylation of WIF-1 in lung cancer cells.
19787276 2009 Promoter hypermethylation of the p16 and Wif-1 genes as an independent prognostic marker in stage IA non-small cell lung cancers.
19773381 2009 Aberrant methylation of APC, MGMT, RASSF2A, and Wif-1 genes in plasma as a biomarker for early detection of colorectal cancer.
19690140 2009 Blockade of Wnt signaling inhibits angiogenesis and tumor growth in hepatocellular carcinoma.
19570204 2009 Prognostic relevance of Wnt-inhibitory factor-1 (WIF1) and Dickkopf-3 (DKK3) promoter methylation in human breast cancer.
19528461 2009 Promoter demethylation of WIF-1 by epigallocatechin-3-gallate in lung cancer cells.
19496188 2009 Promoter methylation and mRNA expression of DKK-3 and WIF-1 in hepatocellular carcinoma.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19307728 2009 Wnt inhibitory factor 1 is epigenetically silenced in human osteosarcoma, and targeted disruption accelerates osteosarcomagenesis in mice.
19188438 2009 Myocilin is a modulator of Wnt signaling.
19174556 2009 WIF1, a Wnt pathway inhibitor, regulates SKP2 and c-myc expression leading to G1 arrest and growth inhibition of human invasive urinary bladder cancer cells.
19085002 2009 WIF-1 promoter region hypermethylation as an adjuvant diagnostic marker for non-small cell lung cancer-related malignant pleural effusions.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
18701434 2008 Adiponectin stimulates Wnt inhibitory factor-1 expression through epigenetic regulations involving the transcription factor specificity protein 1.
18256869 2008 Docking of fatty acids into the WIF domain of the human Wnt inhibitory factor-1.
18093228 2008 Identification of genes differentially expressed by prematurely fused human sutures using a novel in vivo - in vitro approach.
18079202 2008 Wnt pathway inhibitors are strongly down-regulated in pituitary tumors.
18005197 2008 Epigenetic alteration of the Wnt inhibitory factor-1 promoter occurs early in the carcinogenesis of Barrett's esophagus.
17384664 2007 The tumor suppressor Wnt inhibitory factor 1 is frequently methylated in nasopharyngeal and esophageal carcinomas.
17171686 2007 WIF1, an inhibitor of the Wnt pathway, is rearranged in salivary gland tumors.
17094650 2006 [WIF1: perspectives of application in oncology].
17012225 2007 Valproate induces widespread epigenetic reprogramming which involves demethylation of specific genes.
16609023 2006 Combination analysis of hypermethylated Wnt-antagonist family genes as a novel epigenetic biomarker panel for bladder cancer detection.
16525492 2006 Preferential methylation of Wnt inhibitory factor-1 in acute promyelocytic leukemia: an independent poor prognostic factor.
16516163 2006 Wnt inhibitory factor-1, a Wnt antagonist, is silenced by promoter hypermethylation in malignant pleural mesothelioma.
16476441 2006 NMR structure of the WIF domain of the human Wnt-inhibitory factor-1.
16428476 2006 Epigenetic inactivation of Wnt inhibitory factor-1 plays an important role in bladder cancer through aberrant canonical Wnt/beta-catenin signaling pathway.
16427602 2006 Wnt signaling activation and WIF-1 silencing in nasopharyngeal cancer cell lines.
16007117 2005 Frequent epigenetic inactivation of Wnt inhibitory factor-1 in human gastrointestinal cancers.
15735743 2005 Constitutive activation of the Wnt/beta-catenin signalling pathway in acute myeloid leukaemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389810 2005 Inhibition of Wnt signaling downregulates Akt activity and induces chemosensitivity in PTEN-mutated prostate cancer cells.
15377999 2004 Cross-talk between Rac1 GTPase and dysregulated Wnt signaling pathway leads to cellular redistribution of beta-catenin and TCF/LEF-mediated transcriptional activation.
15351726 2004 Cloning and characterization of the promoter of human Wnt inhibitory factor-1.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10201374 1999 A new secreted protein that binds to Wnt proteins and inhibits their activities.