Property Summary

NCBI Gene PubMed Count 114
PubMed Score 32.92
PubTator Score 296.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
lung adenocarcinoma 2.100 1.7e-05
non-small cell lung carcinoma 1.100 1.1e-11
Breast cancer -1.300 8.5e-13
ovarian cancer 1.300 4.8e-10
psoriasis -1.500 1.5e-30

Gene RIF (98)

PMID Text
26928556 Increased WFDC2 expression plays an important role in altering the estrogen pathway in ovarian cancer.
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
26575020 Data suggest that overexpressed human epididymis protein 4 (HE4) played an important role in ovarian cancer progression and metastasis and that HE4 has the potential to serve as therapeutic target for ovarian cancer.
26539494 Endometrial cancer patients with high HE4 expression have a poor prognosis.
26497244 Results show that recombinant HE4 proteins are able to promote the proliferation of pancreatic and endometrial cancer cells suggesting that HE4 secreted from cancer cells may carry out paracrine and endocrine functions in cancer patients.
26362938 Expression levels of ANXA2 and HE4 were closely related to the malignant biological behavior of endometrial carcinoma
26285075 optimal cut-off values (HE4: 70pmol/l for all; CA125: 60U/ml for pre- and 35U/ml for postmenopausal women) could notably improve diagnostic performance in EOC detection in patients in southern China
26117969 High expression of WFDC2 was demonstrated for both, EOC and fallopian tube, as opposed to its low expression observed in normal ovaries suggesting that EOC is derived from fallopian tube rather than ovary
26030627 High serum HE4 level at diagnosis is an independent determinant of poor prognosis in NSCLC.
25920696 Body mass index does not influence HE4 levels in serum.
25867363 Authors examined the serum concentration of human epididymis protein (HE4) in patients with benign gynecological diseases complicated with chronic renal deficiency
25863801 In this report, we describe our use of capillary electrophoresis (CE) as the separation mechanism in the process of selecting DNA aptamers with affinity for the ovarian cancer biomarker HE4.
25834501 HE4 was less elevated and more suitable as a biomarker than CA125 in chinese women with benign disease.
25655024 Serum HE4 measured during clinical follow-up may identify recurrent disease particularly in patients with endometrioid histology.
25577252 Our results suggest a potential role of HE4 in endometrial cancer stage prediction.
25560808 Median serum HE4 concentration was significantly higher in patients with epithelial ovarian cancer compared to patients with ovarian metastases of gastrointestinal origin.
25432133 this study provides new evidence on promotive effects of the HE4 on gastric cancer progression and indicates that HE4 might be a promising prognostic factor for gastric cancer diagnosis.
25431767 we suggest He4 and ROMA score to be considered as routine preoperative assessment in the event that an ovarian mass is diagnosed and malignancy cannot be excluded.
25362534 HE4 and annexin II binding interaction promoted ovarian cancer cell invasion.
25354091 HE4 protein played a promotive role in the proliferation and resistance to carboplatin-induced apoptosis in the ovarian cancer.
25326813 Measurement of combined HE4 and CA125 levels provides a more accurate method for epithelial ovarian cancer diagnosis.
25190018 Serum HE4 and CA125 as predictors of response and outcome during neoadjuvant chemotherapy of advanced high-grade serous ovarian cancer.
25118488 Serum HE4 was not significantly elevated in patients with ovarian endometriosis.
25078339 A HE4 level is a useful preoperative test for predicting the benign or malignant nature of pelvic masses.[review; meta-analysis]
25051914 These findings suggest that HE4 levels are greatly elevated in sera and tumor tissues of patients with SCLC and serum HE4 is a potential diagnostic marker for patients with SCLC.
25018782 the HE4 marker appears to be helpful in forecasting of optimal cytoreduction and possibly also of the prediction of response to platinum analogues used in first-line treatment of ovarian cancer.
24998328 This study demonstrates that overexpression of the Lewis y antigen on HE4 promotes ovarian cancer cell invasion and metastasis, which is likely to be used as a target for the clinical treatment of ovarian cancer.
24975515 HE4 overexpression induces resistance to antiestrogens in ovarian cancer.
24885319 High serum HE4 levels are endometrial cancer.
24879624 Data suggest the feasibility of using serum instead of bronchial aspiration fluid (BAF) samples for human epididymis 4 (HE-4) measurements in lung cancer cases.
24771264 HE4 seems to be superior to Ca125 in terms of diagnostic performance of all premenopausal women
24748235 Our findings suggest that HE4 values during first-line chemotherapy could predict chemotherapy response in epithelial ovarian cancer patients.
24716917 The modified cutoff value of CA125, HE4, RMI score and ROMA were 165.2 U/mL, 103.4 pM, 368.7, 28/54.
24557433 Human epididymis protein 4 might inhibit cell proliferation by regulating the mitogen-activated protein kinase and phosphoinositide 3-kinase/AKT signal transduction pathways in vitro.
24528554 The HE4 marker concentrations in the peritoneal fluid are highly irrespective of the pathology observed in the female sexual organ.
24403483 High HE4 expression is associated with endometrial cancer.
24389815 findings implicate increased HE4 expression as a molecular factor in ovarian cancer tumorigenesis
24252907 HE4 variants exhibit tissue-specific expression, suggesting that each variant may exert distinct functions in normal and malignant cells. HE4 levels appear to correlate with EC patient survival in a variant-specific manner
24217786 High HE4 expression is associated with ovarian cancer relapse.
24083699 High HE4 expression is associated with epithelial ovarian tumours.
24068567 The analysis of published data suggests that HE4 is the most accurate and sensitive endometrial cancer marker identified to date; this new marker seems to have a good performance in diagnosis
24034113 The serum HE4 level may have significance for the differential diagnosis of s LGSG and HGSG
24025389 Serum HE4 may be used as a potential marker to differentiate lung cancer from pulmonary tuberculosis and healthy controls; higher levels of HE4 predict poor prognosis in non-small-cell lung cancer
24023032 Report presence of HE4 in vaginal secretions and its regulation in response to vaginal microbiota and to the concentrations of antimicrobial and proinflammatory mediators.
24012857 Reference intervals for serum HE4, CA125 and risk of ovarian malignancy algorithm in healthy Chinese female were established.
23970060 HE4 serum levels combined with CE CT imaging may improve the monitoring management of women affected by ovarian cancer.
23894390 HE4 contains Lewis y antigen
23640061 Serum levels of HE4 are related to both the stage and grade of tumor in patients with early stage endometrial neoplasms.
23608327 HE4 gene plays an important role in regulating proliferation, apoptosis, migration, invasion of serous ovarian cancer cells by ERK pathway and protease system.
23464464 The concentration of HE4 was noted to increase with age.
23426716 Review: HE4 measurement seems to be superior to CA-125 in terms of diagnostic performance for identification of ovarian cancer.
23353556 HE4 is a potential biomarker of renal fibrosis and a new therapeutic target.
23343214 Measuring serum HE4 concentrations along with CA125 concentrations may provide higher accuracy for detecting epithelial ovarian cancer.
23234010 HE4 is more specific marker to be used for early diagnosis of ovarian cancer.
23139753 HE-4 is a cross-class protease inhibitor which might confer protection against microbial virulence factors of proteolytic nature.
23129262 High WFDC2 expression is associated with ovarian cancer.
23096757 HE4 significant correlation with decreased Overall Survival, Disease Free Survival and Progression Free Survival suggests its potential role as a novel prognostic marker for endometrial cancer
23095772 The combination of HE4 and CA-125 levels at baseline just before initiation of chemotherapy was significantly associated with decreased progression-free and overall survival and to some extent with platinum resistance.
23093277 present consensus statements on the different topics, where available,and suggestions for further studies and evaluations required to establish optimal use of HE4, for diagnostic and prognostic purposes in gynecological malignancies
23093276 HE4 has the highest relevance in ovarian cancer but can be elevated in a variety of benign and malignant diseases
23084584 study demonstrated that up-regulation of the extracellular protease inhibitor HE4 is associated with carcinogenesis in the stomach and pancreas
23001907 High serum HE4 level is associated with pulmonary adenocarcinoma progression.
22993374 Determination of HE4 along with CA125 and ROMA2 index calculation is a suitable method for the improvement of the primary detection of ovarian cancer.
22967799 results show that preoperative plasma level of HE4 is a marker of ovarian cancer aggressiveness and a predictor of death
22962406 Because of the strong effect of age on HE4, thresholds for HE4 are best defined for women of specific ages.
22875782 High serum HE4 is associated with recurrence of ovarian cancer.
22745553 This study aimed to develop a novel localized surface plasmon resonance (LSPR) biosensor for detecting HE4 in blood samples from patients with ovarian cancer.
22684816 The current study reports a novel finding of increased serum and pleural fluid HE4 levels in patients with malignant effusions compared to non-malignant effusions.
22525819 Pretherapeutic serum HE4 levels alone and in combination with CA125 are an independent prognostic marker in endometrial cancer patients.
22524132 HE4 is vastly more specific and early-phase diagnosed tumor marker in cases with ovarian cancer.
22430259 HE4 combined with MDCT imaging is a good marker in the evaluation of disease extension in advanced epithelial ovarian carcinoma.
22426406 adds valuable information to CA125 in identifying patients with epithelial ovarian cancer from those with benign pelvic disease
22373583 Findings suggest that serum epididymis protein 4 (HE4) is a potential diagnostic and prognostic marker for lung cancer.
22342977 these results provide evidence of the cellular and molecular mechanisms that may underlie the motility-promoting role of HE4 in epithelial ovarian cancer progression.
22301440 Above the age of 40 years significant elevations in HE4 concentrations emerged with advancing age. In pregnant women, median HE4 concentrations were significantly lower than their premenopausal counterparts.
22284961 Serum HE4 levels were elevated less frequently than CA125 levels in benign disease, particularly in premenopausal patients.
22117965 This is the first report to demonstrate the functional importance of HE4 in multiple cellular processes and indicates that HE4 may play a protective role in the progression of ovarian cancer
22105734 HE4 levels in healthy subjects are associated with age and smoking status
22037318 HE4 is elevated in a high proportion of endometrial cancer patients.
22015929 These data showed that high-level HE4-V3 expression is associated with a favorable prognosis in lung adenocarcinoma.
21923475 HE4 alone and even more the combined analysis of CA125 and HE4 using risk of malignancy algorithm improve the diagnostic accuracy of adnexal masses, especially in early ovarian cancer.
21833668 High serum HE4 levels significantly correlated with high tumor grade and serous histology in epithelial ovarian cancer. In addition, high serum HE4 levels were significantly associated with residual tumor size and operative time
21738039 increasing levels of serum HE4 was significantly associated with worse progression-free survival and overall survival in ovarian cancer patients
21720250 may be a useful marker preoperatively in the clinical decision process for determining the need for lymph node dissection in women with endometrioid endometrial cancer
21633297 Human epididymis protein 4 used in conjunction with CA 125 yields improved specificity for ovarian cancer compared with the use of CA 125 alone.
21115941 High HE4 expression is associated with lymph node metastases in breast cancer.
20593939 Elevated levels of HE4 is associated with ovarian carcinoma in patients with pelvic masses.
20490961 a statistically significant difference in serum HE4 levels was observed during the different hormonal phases in the group of women under 35 years.
20381233 Measuring HE4 in urine may aid diagnosis and the monitoring of response to the response to therapy in ovarian neoplasms.
19927341 The HE4 level was significantly increased in patients with transitional cell carcinoma compared to patients with benign urinary diseases patients (P<0.01) and healthy controls.
19774626 The median CA125 and HE4 serum levels were significantly higher among ovarian cancer patients as compared with healthy subjects and with those with benign mass, cervical, and endometrial tumor
19732003 HE4 may have more potential than cancer antigen 125 in discriminating benign from cancerous ovarian masses, and has the strongest correlation with endometrial cancer of all markers tested to date. [REVIEW]
19337252 Measuring HE4 serum concentrations increases the accuracy of ovarian cancer diagnosis and provides valuable information to discriminate ovarian tumours from ovarian endometriotic cysts.
18546615 Assays measuring HE4 in serum and other bodily fluids are likely to be clinically useful for patients with ovarian cancer.
17448597 WFDC2 is upregulated after radical prostatectomy for prostatic neoplasms.
16600032 WFDC2 may be a component of the innate immune defences of the lung, nasal and oral cavities that functions in concert with related WAP domain-containing proteins in epithelial host defence.
15781627 HE4 is a secreted glycoprotein that is overexpressed by serous and endometrioid endometrioid ovarian carcinoma.
12839961 This protein's gene is amplified in ovarian carcinoma; it can serve as a tumor marker for this disease.

AA Sequence

MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC      1 - 70
SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF                     71 - 124
//

Text Mined References (114)

PMID Year Title
26928556 2016 WAP four-disulfide core domain protein 2 gene(WFDC2) is a target of estrogen in ovarian cancer cells.
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
26575020 2016 Overexpression of HE4 (human epididymis protein 4) enhances proliferation, invasion and metastasis of ovarian cancer.
26539494 2015 Expression of HE4 in Endometrial Cancer and Its Clinical Significance.
26497244 2016 Recombinant HE4 protein promotes proliferation of pancreatic and endometrial cancer cell lines.
26362938 2015 Expression and clinical significance of annexin A2 and human epididymis protein 4 in endometrial carcinoma.
26285075 2016 Modification of cut-off values for HE4, CA125 and the ROMA algorithm for early-stage epithelial ovarian cancer detection: Results from 1021 cases in South China.
26117969 2015 Ovarian cancer and normal fallopian tube high WFDC2 expression does not correlate with HE4 serum level.
26030627 2015 Serum HE4: An Independent Prognostic Factor in Non-Small Cell Lung Cancer.
25920696 2015 Body mass index does not influence human epididymis protein 4 concentrations in serum.
25867363 2015 Increased human epididymis protein 4 in benign gynecological diseases complicated with chronic renal insufficiency patients.
25863801 2015 Selection of DNA aptamers for ovarian cancer biomarker HE4 using CE-SELEX and high-throughput sequencing.
25834501 2014 Serum HE4 is more suitable as a biomarker than CA125 in Chinese women with benign gynecologic disorders.
25655024 2015 Serum HE4 detects recurrent endometrial cancer in patients undergoing routine clinical surveillance.
25577252 2015 Utility of tumor marker HE4 as prognostic factor in endometrial cancer: a single-center controlled study.
25560808 2015 Serum human epididymal protein 4 (HE4) as biomarker for the differentiation between epithelial ovarian cancer and ovarian metastases of gastrointestinal origin.
25432133 2015 The human epididymis protein 4 acts as a prognostic factor and promotes progression of gastric cancer.
25431767 2014 Borderline ovarian tumors and diagnostic dilemma of intraoperative diagnosis: could preoperative He4 assay and ROMA score assessment increase the frozen section accuracy? A multicenter case-control study.
25362534 2014 Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells.
25354091 2015 Promotive role of recombinant HE4 protein in proliferation and carboplatin resistance in ovarian cancer cells.
25326813 2015 Evaluation of human epididymis protein 4 (HE4) and Risk of Ovarian Malignancy Algorithm (ROMA) as diagnostic tools of type I and type II epithelial ovarian cancer in Japanese women.
25190018 2014 Serum HE4 and CA125 as predictors of response and outcome during neoadjuvant chemotherapy of advanced high-grade serous ovarian cancer.
25118488 2014 Is HE4 a useful endometrioma marker?
25078339 2014 Accuracy of serum human epididymis protein 4 in ovarian cancer diagnosis: a systematic review and meta-analysis.
25051914 2014 Evaluating the expression and diagnostic value of human epididymis protein 4 (HE4) in small cell lung cancer.
25018782 2014 Serum HE4, CA125, YKL-40, bcl-2, cathepsin-L and prediction optimal debulking surgery, response to chemotherapy in ovarian cancer.
24998328 2014 Overexpression of Lewis y antigen promotes human epididymis protein 4-mediated invasion and metastasis of ovarian cancer cells.
24975515 2014 HE4 expression is associated with hormonal elements and mediated by importin-dependent nuclear translocation.
24885319 2014 Diagnostic value of serum HE4 in endometrial cancer: a meta-analysis.
24879624 2014 Serum and bronchial aspiration fluid HE-4 levels in lung cancer.
24771264 2014 HE4, Ca125 and ROMA algorithm for differential diagnosis between benign gynaecological diseases and ovarian cancer.
24748235 2014 Can HE4 predict platinum response during first-line chemotherapy in ovarian cancer?
24716917 2014 Modification of cutoff values for HE4, CA125, the Risk of Malignancy Index, and the Risk of Malignancy Algorithm for ovarian cancer detection in Jakarta, Indonesia.
24557433 2014 Human epididymis protein 4 inhibits proliferation of human ovarian cancer cells via the mitogen-activated protein kinase and phosphoinositide 3-kinase/AKT pathways.
24528554 2014 HE4 tumor marker concentration in neoplastic peritoneal effusion and in peritoneal fluid associated with benign gynecological diseases.
24403483 2014 CA125 and HE4 levels in a Czech female population diagnosed with endometrial cancer in preoperative management.
24389815 2014 HE4 (WFDC2) gene overexpression promotes ovarian tumor growth.
24252907 2013 HE4 transcription- and splice variants-specific expression in endometrial cancer and correlation with patient survival.
24217786 2014 HE4 expression in plasma correlates with surgical outcome and overall survival in patients with first ovarian cancer relapse.
24083699 2013 Pattern of tissue expression of CA-125 and HE4 in primary epithelial ovarian tumours and correlation with serum CA-125 levels.
24068567 2014 A critical review on HE4 performance in endometrial cancer: where are we now?
24034113 2013 Expression of human WFDC2 protein from patients with serous carcinomas by the two-tier system.
24025389 2013 Evaluating the clinical significance of serum HE4 levels in lung cancer and pulmonary tuberculosis.
24023032 2014 Human epididymis protein 4 and secretory leukocyte protease inhibitor in vaginal fluid: relation to vaginal components and bacterial composition.
24012857 2013 The reference intervals for HE4, CA125 and ROMA in healthy female with electrochemiluminescence immunoassay.
23970060 2013 Serum HE4 levels combined with CE CT imaging improve the management of monitoring women affected by epithelial ovarian cancer.
23894390 2013 Co-expression of Lewis y antigen with human epididymis protein 4 in ovarian epithelial carcinoma.
23640061 2013 The diagnostic role of human epididymis protein 4 and serum amyloid-A in early-stage endometrial cancer patients.
23608327 2013 Effect of WFDC 2 silencing on the proliferation, motility and invasion of human serous ovarian cancer cells in vitro.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23464464 2012 Human epididymis protein 4 reference intervals in a multiethnic asian women population.
23426716 2013 Serum human epididymis protein 4 vs carbohydrate antigen 125 for ovarian cancer diagnosis: a systematic review.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353556 2013 Identification of human epididymis protein-4 as a fibroblast-derived mediator of fibrosis.
23343214 2013 Significance of HE4 estimation in comparison with CA125 in diagnosis of ovarian cancer and assessment of treatment response.
23234010 2012 [HE4 and CA125 in ovarian cancer].
23139753 2012 Human epididymis protein-4 (HE-4): a novel cross-class protease inhibitor.
23129262 2013 WAP four-disulfide core domain protein 2 mediates the proliferation of human ovarian cancer cells through the regulation of growth- and apoptosis-associated genes.
23096757 2012 Human epididymis protein 4 as a serum marker for diagnosis of endometrial carcinoma and prediction of clinical outcome.
23095772 2012 The prognostic and predictive value of combined HE4 and CA-125 in ovarian cancer patients.
23093277 2012 HE4 in gynecological cancers: report of a European investigators and experts meeting.
23093276 2012 Human epididymis protein 4 (HE4) in benign and malignant diseases.
23084584 2013 Human epididymis protein 4 is up-regulated in gastric and pancreatic adenocarcinomas.
23001907 2012 Serum level of HE4 is closely associated with pulmonary adenocarcinoma progression.
22993374 2012 HE4 and ROMA index in Czech postmenopausal women.
22967799 2012 Human epididymis protein 4 (HE4) and ovarian cancer prognosis.
22962406 2012 Interpretation of single and serial measures of HE4 and CA125 in asymptomatic women at high risk for ovarian cancer.
22875782 2012 Does HE4 have a role as biomarker in the recurrence of ovarian cancer?
22745553 2012 Detection of serum human epididymis secretory protein 4 in patients with ovarian cancer using a label-free biosensor based on localized surface plasmon resonance.
22684816 2012 Evaluation of pleural fluid human epididymis 4 (HE4) as a marker of malignant pleural effusion.
22525819 2012 HE4 is an independent prognostic marker in endometrial cancer patients.
22524132 2011 [HE4--a new tumor marker for ovarian cancer].
22430259 2012 HE4 combined with MDCT imaging is a good marker in the evaluation of disease extension in advanced epithelial ovarian carcinoma.
22426406 2012 Serum HE4 as a useful biomarker in discriminating ovarian cancer from benign pelvic disease.
22373583 2012 Serum HE4 as a diagnostic and prognostic marker for lung cancer.
22342977 2012 Human epididymis protein 4 (HE4) plays a key role in ovarian cancer cell adhesion and motility.
22301440 2012 Serum levels of the ovarian cancer biomarker HE4 are decreased in pregnancy and increase with age.
22284961 2012 Serum HE4 levels are less frequently elevated than CA125 in women with benign gynecologic disorders.
22117965 2011 The role of HE4 in ovarian cancer: inhibiting tumour cell proliferation and metastasis.
22105734 2012 Human epididymis protein 4 reference limits and natural variation in a Nordic reference population.
22037318 2012 Correlation of serum HE4 with tumor size and myometrial invasion in endometrial cancer.
22015929 2012 Splice variant HE4-V3 expression is associated with favorable prognosis in pulmonary adenocarcinoma.
21923475 2011 The diagnostic accuracy of two human epididymis protein 4 (HE4) testing systems in combination with CA125 in the differential diagnosis of ovarian masses.
21833668 2012 Serum HE4 level is an independent prognostic factor in epithelial ovarian cancer.
21738039 2011 Prognostic impact of prechemotherapy serum levels of HER2, CA125, and HE4 in ovarian cancer patients.
21720250 2011 Utility of tumor marker HE4 to predict depth of myometrial invasion in endometrioid adenocarcinoma of the uterus.
21633297 2011 Human epididymis protein 4 (HE4) as a serum tumor biomarker in patients with ovarian carcinoma.
21115941 2010 HE4 expression can be associated with lymph node metastases and disease-free survival in breast cancer.
20593939 2010 HE4 and mesothelin: novel biomarkers of ovarian carcinoma in patients with pelvic masses.
20490961 2010 Ovarian tumor marker HE4 is differently expressed during the phases of the menstrual cycle in healthy young women.
20381233 2010 Detection of the HE4 protein in urine as a biomarker for ovarian neoplasms.
20171287 2010 Voxelwise genome-wide association study (vGWAS).
19927341 2009 Human epididymis protein 4 is a biomarker for transitional cell carcinoma in the urinary system.
19774626 2009 The utility of serum human epididymis protein 4 (HE4) in patients with a pelvic mass.
19732003 2009 HE4 as a biomarker for ovarian and endometrial cancer management.
19337252 2009 Serum HE4 concentration differentiates malignant ovarian tumours from ovarian endometriotic cysts.
18546615 2008 SMRP and HE4 as biomarkers for ovarian carcinoma when used alone and in combination with CA125 and/or each other.
17448597 2008 Marked gene transcript level alterations occur early during radical prostatectomy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16600032 2006 WFDC2 (HE4): a potential role in the innate immunity of the oral cavity and respiratory tract and the development of adenocarcinomas of the lung.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
15781627 2005 Human epididymis protein 4 (HE4) is a secreted glycoprotein that is overexpressed by serous and endometrioid ovarian carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12839961 2003 The HE4 (WFDC2) protein is a biomarker for ovarian carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11965550 2002 The putative ovarian tumour marker gene HE4 (WFDC2), is expressed in normal tissues and undergoes complex alternative splicing to yield multiple protein isoforms.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10570965 1999 Comparative hybridization of an array of 21,500 ovarian cDNAs for the discovery of genes overexpressed in ovarian carcinomas.
9685187 1998 Molecular characterization of epididymal proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1693137 1990 Cloning and analysis of mRNAs expressed specifically in the human epididymis.
1686187 1991 A major human epididymis-specific cDNA encodes a protein with sequence homology to extracellular proteinase inhibitors.