Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.23
PubTator Score 1.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.400 6.1e-04
medulloblastoma, large-cell 1.500 7.7e-05
osteosarcoma 1.636 2.6e-08
ovarian cancer 1.200 6.9e-13
psoriasis 2.100 9.5e-28

Gene RIF (1)

AA Sequence

MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKC      1 - 70
VIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK                                  71 - 111
//

Text Mined References (6)

PMID Year Title