Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MVSLMKLWIPMLMTFFCTVLLSVLGEMRKKRYDRKELLLEECWGKPNVKECTNKCSKAFRCKDKNYTCCW      1 - 70
TYCGNICWINVETSGDY                                                          71 - 87
//

Text Mined References (8)

PMID Year Title