Property Summary

NCBI Gene PubMed Count 6
PubMed Score 11.54
PubTator Score 5.22

Knowledge Summary

Patent (159)

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 7.3e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Western equine encephalitis 13 6.047 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 7.3e-09

AA Sequence

MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSS      1 - 70
EKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRLVISPTGKLPSRGPKHLKLTP     71 - 140
APLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDLEEAGPEEGKGGLPAKRCVLRETNMASRYEK    141 - 210
EFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWA    211 - 280
EDDHMIIQNEYCNGGSLQAAISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHK    281 - 350
MQSESSGVIEEVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFAL    351 - 420
GLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAALARNTVLRPSL    421 - 490
GKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTGSRSTKRLVGGKSARSSSFTS    491 - 560
GEREPLH                                                                   561 - 567
//

Text Mined References (8)

PMID Year Title