Property Summary

Ligand Count 76
NCBI Gene PubMed Count 112
PubMed Score 311.74
PubTator Score 183.69

Knowledge Summary

Patent (15,143)

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 2.800 3.2e-05
astrocytoma 1.800 1.1e-12
Astrocytoma, Pilocytic 2.700 2.5e-08
atypical teratoid / rhabdoid tumor 3.300 4.1e-09
Breast cancer -1.400 1.8e-21
chronic rhinosinusitis -1.524 6.5e-03
cutaneous lupus erythematosus -1.800 2.0e-02
ductal carcinoma in situ 1.300 6.8e-03
ependymoma 4.100 8.1e-24
glioblastoma 3.400 7.3e-13
group 3 medulloblastoma 3.400 1.2e-05
interstitial cystitis -1.600 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.9e-02
lung carcinoma -1.500 1.0e-11
medulloblastoma, large-cell 2.600 2.8e-04
non primary Sjogren syndrome sicca -1.100 2.1e-02
oligodendroglioma 1.800 6.9e-10
primitive neuroectodermal tumor 3.200 1.4e-06
psoriasis -3.100 4.5e-05

Protein-protein Interaction (1)

PDB (14)

Gene RIF (98)

AA Sequence

MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTE      1 - 70
PGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFGSSSPVKSPAAPYFLGSSFSP     71 - 140
VRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFRKLRLFDTPHTPKSLLSKARGIDSSSVKLRG    141 - 210
SSLFMDTEKSGKREFDVRQTPQVNINPFTPDSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRP    211 - 280
AKRITITESNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAH    281 - 350
AVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM    351 - 420
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQE    421 - 490
NYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSA    491 - 560
MALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTS    561 - 630
RLIGKKMNRSVSLTIY                                                          631 - 646
//

Text Mined References (120)

PMID Year Title