Property Summary

NCBI Gene PubMed Count 100
PubMed Score 288.31
PubTator Score 183.69

Knowledge Summary

Patent (15,143)

Expression

  Differential Expression (19)

Disease log2 FC p
cutaneous lupus erythematosus -1.800 2.0e-02
psoriasis -3.100 4.5e-05
astrocytoma 1.800 1.1e-12
glioblastoma 3.400 7.3e-13
oligodendroglioma 1.800 6.9e-10
posterior fossa group A ependymoma 4.300 1.8e-21
sonic hedgehog group medulloblastoma 3.500 4.4e-08
atypical teratoid/rhabdoid tumor 3.500 1.6e-11
medulloblastoma, large-cell 2.600 2.8e-04
primitive neuroectodermal tumor 3.200 1.4e-06
intraductal papillary-mucinous neoplasm ... 1.200 3.9e-02
interstitial cystitis -1.900 8.4e-06
pediatric high grade glioma 3.600 2.1e-10
pilocytic astrocytoma 2.700 2.0e-08
non primary Sjogren syndrome sicca -1.100 2.1e-02
lung carcinoma -1.800 1.4e-09
Breast cancer -1.400 1.8e-21
ductal carcinoma in situ 1.300 6.8e-03
chronic rhinosinusitis -1.524 6.5e-03

Protein-protein Interaction (1)

Gene RIF (86)

PMID Text
26645158 These results suggest that the G2 checkpoint inhibitor MK-1775 can enhance the sensitivity of human NSCLC cells to C ions as well as X rays.
26602815 Data show that H3K36me3-deficient cancers can be targeted by inhibition of WEE1 protein.
26598692 data indicate that the activity of the DNA replication machinery, beyond TP53 mutation status, determines Wee1 inhibitor sensitivity, and could serve as a selection criterion for Wee1-inhibitor eligible patients
26431163 Data show that proto-oncogene protein Mdm2 inactivation successfully protects tumor suppressor protein (p53)-proficient cells against the cytotoxic effects of Wee1 protein inhibition.
26054341 These data provide a rationale for further evaluation of the combination of Wee1 and Chk1/2 inhibitors in malignant melanoma.
26025928 nasopharyngeal carcinoma cells depend on CHK1 and WEE1 activity for growth
25732734 WEE1 is a valid target of the miR-17-92 cluster in leukemia.
25659151 identified the PI3K/Akt pathway, the cell-cycle regulator Wee1 kinase, and protein kinase C (PKC) as prospective regulatory nodes of neuronal excitability through modulation of the FGF14:Nav1.6 complex.
25649652 This study showed that WEE1 (rs10770042; coding) associated with Alzheimer disease.
25428911 Report strong synergism observed by combining Chk1 and Wee1 inhibitors in preclinical models of mantle cell lymphoma.
25247294 Study shows that CHD5 is a Nucleosome remodeling and deacetylase complex-associated transcriptional repressor and identifies WEE1 as one of the CHD5-regulated genes that may link CHD5 to tumor suppression.
25093290 Wee1 is frequently expressed in ovarian serous carcinoma effusions, and its expression is significantly higher following exposure to chemotherapy and it is an independent prognostic marker in serous ovarian carcinoma.
24927813 These results suggest that specific inhibition of Wee1 has deleterious effects on the proliferation and survival of p53 inactive tumors.
24817118 role for CK1delta in controlling the cell cycle
24744753 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
24661910 Taken together, these findings highlight mitotic kinases and, in particular, WEE1 as a rational therapeutic target for medulloblastoma.
24626094 Inhibition of WEE1 counters the defective apoptosis of tumor cells expressing high levels of brachyury.
24536047 A novel mechanism that pancreatic ductal adenocarcinoma cells use to protect against DNA damage in which HuR posttranscriptionally regulates the expression and downstream function of WEE1 upon exposure to DNA-damaging agents.
24424027 Regulation of the mitotic inhibitor Wee1 by TOR signalling is a conserved mechanism that helps to couple cell cycle and growth controls.
24377575 High WEE1 expression is associated with breast cancer.
24336073 miR-16 and miR-26a target checkpoint kinases Wee1 and Chk1 in response to p53 activation by genotoxic stress.
24158819 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
23767999 Our results suggest that Wee1 may be involved in the progression of vulvar carcinomas
23538902 Together, these studies have identified Wee1 as a key target of XL888, suggesting novel therapeutic strategies for NRAS-mutant melanoma.
23531080 miR-497 is a candidate tumor suppressor in neuroblastoma, through the direct targeting of WEE1.
23416158 AURKB and WEE1 are targets and biomarkers of therapeutic efficacy, lying downstream of (V600E)B-RAF in melanomas.
23051732 These data support the hypothesis that Cdc14A counteracts Cdk1-cyclin B1 activity through Wee1 dephosphorylation.
22942255 Loss-of-function and gain-of-function studies showed that miR-15 family members controlled the expression of WEE1 and CHK1.
22935698 Wee1 inhibition sensitizes cancer cells to Hsp90 inhibitors.
22907750 The results suggested that deregulated CDK1 activity, such as that occurring following inhibition of WEE1 kinase, induces replication stress and loss of genomic integrity through increased firing of replication origins and subsequent nucleotide shortage.
22847610 study shows WEE1 expression in malignant melanoma is directly regulated by miR-195; miR-195-mediated downregulation of WEE1 in metastatic lesions may help to overcome cell cycle arrest under stress conditions in the local tissue microenvironment to allow unrestricted growth of tumour cells
22719872 results reveal the importance of Wee1 as a prognostic biomarker in melanomas, and indicate a potential role for targeted therapy, alone or in combination with other agents
22692537 Data identify Cdc20, USP44, and Wee1 as relevant Fcp1 targets.
22641220 WEE1 accumulation and deregulation of S-phase proteins mediate MLN4924 potent inhibitory effect on Ewing sarcoma cells.
22289989 Elevated WEE1 expression is associated with acute myeloid leukemia.
22112940 Sensitization effects of WEE1 inhibition on TRAIL-mediated apoptosis in breast cancer cell lines.
21859861 Results demonstrate a novel role of Wee1 in controlling Mus81-Eme1 and DNA replication in human cells.
21529352 WEE1 inhibition may be a promising strategy to enhance the radiotherapy effect in patients with OS.
21358821 The over-expression of the naturally under-expressed miR-128 in glioma cells resulted in the inhibition of WEE1 in glioblastoma cells.
21318276 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
20832752 WEE1 is a major regulator of the G(2) checkpoint in glioblastoma cells.
20668041 Regulation of Wee1 kinase by miRs may be linked to pituitary tumorigenesis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
20372791 analysis of interaction sites between Wee1 kinase and the regulatory beta-subunit of protein kinase CK2
20038582 multiple regions of Wee1 control its destruction
20012529 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903823 Abrogation of G(2) arrest by inhibition of ATM and ATR, Chk1, and Wee1 suppressed JCV genome replication.
19858290 These studies identify a novel bifunctional regulatory element in Wee1 that mediates cyclin A/Cdk2 association and nuclear export.
19821025 Results identify WEE1 as a potential molecular target in breast cancer.
19275588 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
19126550 Cdc34 is a functional target of let-7 and that let-7 induces down-regulation of Cdc34, stabilization of the Wee1 kinase, and an increased fraction of cells in G(2)/M in primary fibroblasts.
19020832 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
18950845 Observational study of gene-disease association. (HuGE Navigator)
18820127 HSP90 inhibition abrogates the topoisomerase I poison-induced G2/M checkpoint in p53-null tumor cells by depleting CHK1 and WEE1.
18560763 These findings support the view that CK2beta regulates various intracellular processes by modulating the activity of protein kinases that are distinct from CK2.
18514189 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
18385244 HIV-1 Vpr binds to the N lobe of the Wee1 kinase domain and enhances kinase activity for CDC2.
18385244 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
17764157 Significant percentage of the total endogenous Crk II partitions in the nucleus in mammalian cells, where it forms distinct complexes with DOCK180, Wee1, and Abl.
17687495 WEE1 can be introduced to rescue cells from the damage caused by certain antineoplastic agents.
17586317 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
17431037 Gamma-irradiated human primary prostate epithelial cells were unable to enforce cell cycle checkpoint arrest and had sustained Cdk2-associated kinase activity because of a lack of inhibitory Cdk phosphorylation by Wee1A tyrosine kinase.
16533053 our studies indicate that the 2-ME(2)-induced upregulation of wee1 and subsequent cdc2 phosphorylation are mediated through mitogen-activated protein kinase (MAPK)-ERK-JNK signaling pathways.
16429131 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
16354571 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
15964826 Akt protein phosphorylation and inactivation of WEE1 promote cell cycle progression at G2/M transition.
15817944 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
15780175 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
15735666 Level of WEE1 is regulated by KLF2 and enhanced KLF2 expression sensitizes cells to DNA damage-induced apoptosis.
15725353 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
15583029 Inhibiting Hsl7 delayed mitosis but overexpression overrode the replication checkpoint, accelerating Wee1 destruction. Checkpoint activation disrupted Hsl7-Wee1 binding which was restored by polo-like kinase. Hsl7 is a replication checkpoint component
15265780 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
15254189 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
15175024 the induction of Cdc2 phosphorylation due to the increase of Wee1 and Myt1 as well as the reduction of Cdc2 and cyclin B1 are involved in 1,25[OH]2VD3-induced G2/M arrest of keratinocytes.
15142377 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
15070733 beta-TrCP-dependent degradation of Wee1A is important for the normal onset of M-phase in vivo.
14760118 Loss of Wee1 expression may have a potential role in promoting tumor progression and may be a significant prognostic indicator in NSCLC.
14534529 WEE1 is directly transactivated by and increased in association with c-Fos/AP-1.
12669309 Proteasome-dependent degradation of this protein is inhibited in G2-arrested Hep3B cells by TGF beta 1.
12601350 increases of cyclin D1, cyclin-dependent kinase 4, cyclin E, cyclin A, and Wee1 play an important role in the development of hepatocellular carcinoma from cirrhosis
12525641 Wee-1 may serve as a key regulator of both HIV type 1 Vpr- and gamma irradiation-mediated apoptosis
12525641 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
11691994 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase
11531413 Prolonged cell cycle arrest in the G2 phase induced by HIV-1 Vpr results in the depletion of Wee1 kinase

AA Sequence

MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTE      1 - 70
PGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFGSSSPVKSPAAPYFLGSSFSP     71 - 140
VRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFRKLRLFDTPHTPKSLLSKARGIDSSSVKLRG    141 - 210
SSLFMDTEKSGKREFDVRQTPQVNINPFTPDSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRP    211 - 280
AKRITITESNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAH    281 - 350
AVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM    351 - 420
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQE    421 - 490
NYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSA    491 - 560
MALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTS    561 - 630
RLIGKKMNRSVSLTIY                                                          631 - 646
//

Text Mined References (108)

PMID Year Title
26645158 2015 Targeting of Carbon Ion-Induced G2 Checkpoint Activation in Lung Cancer Cells Using Wee-1 Inhibitor MK-1775.
26602815 2015 Inhibiting WEE1 Selectively Kills Histone H3K36me3-Deficient Cancers by dNTP Starvation.
26598692 2015 A haploid genetic screen identifies the G1/S regulatory machinery as a determinant of Wee1 inhibitor sensitivity.
26431163 2015 Mdm2 inhibition confers protection of p53-proficient cells from the cytotoxic effects of Wee1 inhibitors.
26054341 2015 Combined inhibition of the cell cycle related proteins Wee1 and Chk1/2 induces synergistic anti-cancer effect in melanoma.
26025928 2015 Pharmacological inactivation of CHK1 and WEE1 induces mitotic catastrophe in nasopharyngeal carcinoma cells.
25732734 2015 WEE1 is a validated target of the microRNA miR-17-92 cluster in leukemia.
25659151 2015 Identifying a kinase network regulating FGF14:Nav1.6 complex assembly using split-luciferase complementation.
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
25428911 2015 Combined inhibition of Chk1 and Wee1 as a new therapeutic strategy for mantle cell lymphoma.
25247294 2014 The chromatin remodeling factor CHD5 is a transcriptional repressor of WEE1.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25093290 2014 Wee1 is a novel independent prognostic marker of poor survival in post-chemotherapy ovarian carcinoma effusions.
24927813 2014 Genetic inhibition of the atypical kinase Wee1 selectively drives apoptosis of p53 inactive tumor cells.
24817118 2014 Casein kinase 1?-dependent Wee1 protein degradation.
24661910 2014 Integrated genomic analysis identifies the mitotic checkpoint kinase WEE1 as a novel therapeutic target in medulloblastoma.
24626094 2014 WEE1 inhibition alleviates resistance to immune attack of tumor cells undergoing epithelial-mesenchymal transition.
24536047 2014 HuR posttranscriptionally regulates WEE1: implications for the DNA damage response in pancreatic cancer cells.
24424027 2014 Torin1-mediated TOR kinase inhibition reduces Wee1 levels and advances mitotic commitment in fission yeast and HeLa cells.
24377575 2014 Tumour suppressive effects of WEE1 gene silencing in breast cancer cells.
24336073 2013 miR-16 and miR-26a target checkpoint kinases Wee1 and Chk1 in response to p53 activation by genotoxic stress.
23767999 2013 High expression of wee1 is associated with malignancy in vulvar squamous cell carcinoma patients.
23538902 2013 Inhibition of Wee1, AKT, and CDK4 underlies the efficacy of the HSP90 inhibitor XL888 in an in vivo model of NRAS-mutant melanoma.
23531080 2013 MicroRNA-497 increases apoptosis in MYCN amplified neuroblastoma cells by targeting the key cell cycle regulator WEE1.
23416158 2013 Identification of aurora kinase B and Wee1-like protein kinase as downstream targets of (V600E)B-RAF in melanoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23051732 2012 Human Cdc14A regulates Wee1 stability by counteracting CDK-mediated phosphorylation.
22942255 2012 Cisplatin sensitivity mediated by WEE1 and CHK1 is mediated by miR-155 and the miR-15 family.
22935698 2012 Combined inhibition of Wee1 and Hsp90 activates intrinsic apoptosis in cancer cells.
22907750 2012 Cyclin-dependent kinase suppression by WEE1 kinase protects the genome through control of replication initiation and nucleotide consumption.
22847610 2013 Regulation of cell cycle checkpoint kinase WEE1 by miR-195 in malignant melanoma.
22719872 2012 High expression of Wee1 is associated with poor disease-free survival in malignant melanoma: potential for targeted therapy.
22692537 2012 Fcp1-dependent dephosphorylation is required for M-phase-promoting factor inactivation at mitosis exit.
22641220 2013 WEE1 accumulation and deregulation of S-phase proteins mediate MLN4924 potent inhibitory effect on Ewing sarcoma cells.
22289989 2012 Integrated genomic analyses identify WEE1 as a critical mediator of cell fate and a novel therapeutic target in acute myeloid leukemia.
22112940 2012 WEE1 inhibition sensitizes basal breast cancer cells to TRAIL-induced apoptosis.
21859861 2011 Wee1 controls genomic stability during replication by regulating the Mus81-Eme1 endonuclease.
21529352 2011 WEE1 inhibition sensitizes osteosarcoma to radiotherapy.
21358821 2011 Prediction of Associations between microRNAs and Gene Expression in Glioma Biology.
20832752 2010 In silico analysis of kinase expression identifies WEE1 as a gatekeeper against mitotic catastrophe in glioblastoma.
20668041 2010 Down-regulation of Wee1 kinase by a specific subset of microRNA in human sporadic pituitary adenomas.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20372791 2010 Mapping of the interaction sites between Wee1 kinase and the regulatory beta-subunit of protein kinase CK2.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20038582 2010 Activation domain-dependent degradation of somatic Wee1 kinase.
20026642 2010 Persistence of the cell-cycle checkpoint kinase Wee1 in SadA- and SadB-deficient neurons disrupts neuronal polarity.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903823 2010 Large T antigen promotes JC virus replication in G2-arrested cells by inducing ATM- and ATR-mediated G2 checkpoint signaling.
19858290 2010 A bifunctional regulatory element in human somatic Wee1 mediates cyclin A/Cdk2 binding and Crm1-dependent nuclear export.
19821025 2010 Identification of WEE1 as a potential molecular target in cancer cells by RNAi screening of the human tyrosine kinome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19126550 2009 let-7 Overexpression leads to an increased fraction of cells in G2/M, direct down-regulation of Cdc34, and stabilization of Wee1 kinase in primary fibroblasts.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18820127 2009 90-kDa heat shock protein inhibition abrogates the topoisomerase I poison-induced G2/M checkpoint in p53-null tumor cells by depleting Chk1 and Wee1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18560763 2008 Ability of CK2beta to selectively regulate cellular protein kinases.
18385244 2008 Human immunodeficiency virus type 1 Vpr binds to the N lobe of the Wee1 kinase domain and enhances kinase activity for CDC2.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17764157 2007 Proapoptotic function of the nuclear Crk II adaptor protein.
17687495 2007 Effect of human WEE1 and stem cell factor on human CD34+ umbilical cord blood cell damage induced by chemotherapeutic agents.
17431037 2007 Human prostate epithelium lacks Wee1A-mediated DNA damage-induced checkpoint enforcement.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16533053 2006 Modulation of cell-cycle regulatory signaling network by 2-methoxyestradiol in prostate cancer cells is mediated through multiple signal transduction pathways.
15964826 2005 Akt/protein kinase B-dependent phosphorylation and inactivation of WEE1Hu promote cell cycle progression at G2/M transition.
15837193 2005 Structure and inhibition of the human cell cycle checkpoint kinase, Wee1A kinase: an atypical tyrosine kinase with a key role in CDK1 regulation.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15735666 2005 Transcriptional repression of WEE1 by Kruppel-like factor 2 is involved in DNA damage-induced apoptosis.
15583029 2004 DNA replication checkpoint control of Wee1 stability by vertebrate Hsl7.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15253423 Identification of phosphorylation sites in protein kinase A substrates using artificial neural networks and mass spectrometry.
15175024 2004 Keratinocyte G2/M growth arrest by 1,25-dihydroxyvitamin D3 is caused by Cdc2 phosphorylation through Wee1 and Myt1 regulation.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15150265 2004 Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function.
15070733 2004 M-phase kinases induce phospho-dependent ubiquitination of somatic Wee1 by SCFbeta-TrCP.
14760118 2004 The clinical significance of Cyclin B1 and Wee1 expression in non-small-cell lung cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14534529 2003 Human wee1 kinase is directly transactivated by and increased in association with c-Fos/AP-1: rheumatoid synovial cells overexpressing these genes go into aberrant mitosis.
12679038 2003 Tome-1, a trigger of mitotic entry, is degraded during G1 via the APC.
12669309 2003 Inhibition of proteasome-dependent degradation of Wee1 in G2-arrested Hep3B cells by TGF beta 1.
12601350 2003 Cyclins and cyclin-dependent kinases: comparative study of hepatocellular carcinoma versus cirrhosis.
12525641 2003 Depletion of Wee-1 kinase is necessary for both human immunodeficiency virus type 1 Vpr- and gamma irradiation-induced apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12214061 2001 Constitutive Wee1 activity in adult brain neurons with M phase-type alterations in Alzheimer neurodegeneration.
12186947 2002 A novel chk1-dependent G1/M checkpoint in fission yeast.
11839808 2002 Apoptotic regulation by the Crk adapter protein mediated by interactions with Wee1 and Crm1/exportin.
11691994 2001 Dynamic disruptions in nuclear envelope architecture and integrity induced by HIV-1 Vpr.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11528126 2001 Comparative architectural aspects of regions of conserved synteny on human chromosome 11p15.3 and mouse chromosome 7 (including genes WEE1 and LMO1).
10775038 2000 Binding of 14-3-3beta to the carboxyl terminus of Wee1 increases Wee1 stability, kinase activity, and G2-M cell population.
10564259 1999 Mechanisms of G2 arrest in response to overexpression of p53.
9618490 1998 Caspase-dependent activation of cyclin-dependent kinases during Fas-induced apoptosis in Jurkat cells.
9268380 1997 Human Myt1 is a cell cycle-regulated kinase that inhibits Cdc2 but not Cdk2 activity.
8432534 1993 Localization of human cell cycle regulatory genes CDC25C to 5q31 and WEE1 to 11p15.3-11p15.1 by fluorescence in situ hybridization.
8428596 1993 Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15.
8348613 1993 Human wee1 maintains mitotic timing by protecting the nucleus from cytoplasmically activated Cdc2 kinase.
8084605 1994 p56/p53lyn tyrosine kinase activation in mammalian cells treated with mitomycin C.
7774574 1995 Cell cycle regulation of human WEE1.
7743995 1995 Regulation of the human WEE1Hu CDK tyrosine 15-kinase during the cell cycle.
7673359 1995 Subcellular localisation of human wee1 kinase is regulated during the cell cycle.
1840647 1991 Wee1(+)-like gene in human cells.
1396589 1992 Cell cycle regulation of CDK2 activity by phosphorylation of Thr160 and Tyr15.
1384126 1992 Inactivation of the p34cdc2-cyclin B complex by the human WEE1 tyrosine kinase.