Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.80
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
invasive ductal carcinoma 1.300 1.6e-02
lung cancer 1.700 8.8e-03
non-small cell lung cancer 1.075 3.7e-14
ovarian cancer 1.700 1.1e-03
tuberculosis 1.300 1.6e-05

Gene RIF (1)

AA Sequence

MEGNGPAAVHYQPASPPRDACVYSSCYCEENIWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQAR      1 - 70
PGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADSYLK     71 - 140
NFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC         141 - 205
//

Text Mined References (15)

PMID Year Title