Property Summary

NCBI Gene PubMed Count 12
PubMed Score 25187.64
PubTator Score 157.51

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GO Component (2)

Gene RIF (4)

PMID Text
23512946 High adp expression in human adipose tissue is associated with lower adiposity and enhanced glucose utilization.
19238144 WDTC1 variation may be an important risk factor contributing to obesity in both Puerto Rican and white populations.
19238144 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of WD and tetratricopeptide repeats 1 (WDTC1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAKVNITRDLIRRQIKERGALSFERRYHVTDPFIRRLGLEAELQGHSGCVNCLEWNEKGDLLASGSDDQH      1 - 70
TIVWDPLHHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETIHMFGDHTNRVKRI     71 - 140
ATAPMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVR    141 - 210
LYDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPNG    211 - 280
TELLVNMGGEQVYLFDLTYKQRPYTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRG    281 - 350
HVSPQVELPPYLERVKQQANEAFACQQWTQAIQLYSKAVQRAPHNAMLYGNRAAAYMKRKWDGDHYDALR    351 - 420
DCLKAISLNPCHLKAHFRLARCLFELKYVAEALECLDDFKGKFPEQAHSSACDALGRDITAALFSKNDGE    421 - 490
EKKGPGGGAPVRLRSTSRKDSISEDEMVLRERSYDYQFRYCGHCNTTTDIKEANFFGSNAQYIVSGSDDG    491 - 560
SFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGIDPVVRLWNPRPESEDLTGRVVEDMEGASQA    561 - 630
NQRRMNADPLEVMLLNMGYRITGLSSGGAGASDDEDSSEGQVQCRPS                           631 - 677
//

Text Mined References (16)

PMID Year Title
23512946 2013 Adipose tissue expression of adipose (WDTC1) gene is associated with lower fat mass and enhanced insulin sensitivity in humans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19238144 2009 WDTC1, the ortholog of Drosophila adipose gene, associates with human obesity, modulated by MUFA intake.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964240 2006 Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12717455 2003 Control of triglyceride storage by a WD40/TPR-domain protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.