Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.7e-06
ovarian cancer 8520 1.2e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.854 1.7e-06
ovarian cancer -1.100 1.2e-04

AA Sequence

MVKLIHTLADHGDDVNCCAFSFSLLATCSLDKTIRLYSLRDFTELPHSPLKFHTYAVHCCCFSPSGHILA      1 - 70
SCSTDGTTVLWNTENGQMLAVMEQPSGSPVRVCQFSPDSTCLASGAADGTVVLWNAQSYKLYRCGSVKDG     71 - 140
SLAACAFSPNGSFFVTGSSCGDLTVWDDKMRCPHSEKAHDLGITCCDFSSQPVSDGEQGLQFFRLASCGQ    141 - 210
DCQVKIWIVSFTHILGFELKYKSTLSGHCAPVLACAFSHDGQMLVSGSVDKSVIVYDTNTENILHTLTQH    211 - 280
TRYVTTCAFAPNTLLLATGSMDKTVNIWQFDLETLCQARRTEHQLKQFTEDWSEEDVSTWLCAQDLKDLV    281 - 350
GIFKMNNIDGKELLNLTKESLADDLKIESLGLRSKVLRKIEELRTKVKSLSSGIPDEFICPITRELMKDP    351 - 420
VIASDGYSYEKEAMENWISKKKRTSPMTNLVLPSAVLTPNRTLKMAINRWLETHQK                  421 - 476
//

Text Mined References (7)

PMID Year Title