Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.8e-04
group 3 medulloblastoma 2254 1.8e-03


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.550 4.8e-04
group 3 medulloblastoma 1.100 1.8e-03

AA Sequence

GAIEKTFTKKESMKIASSVHQRVRVHSNDSYKRRKKQ                                     351 - 387

Text Mined References (8)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.