Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.64

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFAN      1 - 70
SRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW                                       71 - 106
//

Text Mined References (6)

PMID Year Title