Property Summary

NCBI Gene PubMed Count 48
PubMed Score 24.70
PubTator Score 16.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 96 0.0 0.0
Disease Target Count
ovarian neoplasm 93
Disease Target Count P-value
lung cancer 4607 2.6e-03

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.500 2.6e-03

Protein-protein Interaction (8)

Gene RIF (20)

AA Sequence

MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNE      1 - 70
GFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQA     71 - 140
VSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSA    141 - 210
PGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSL    211 - 280
AVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE            281 - 342
//

Text Mined References (55)

PMID Year Title