Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.92
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.300 3.1e-03
Breast cancer 2.800 3.1e-02
gastric cancer 1.200 2.4e-04
glioblastoma 1.400 4.0e-04
group 3 medulloblastoma 1.800 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.3e-03
malignant mesothelioma 1.900 2.0e-07
medulloblastoma, large-cell 1.100 2.1e-04
osteosarcoma -4.017 4.5e-06
pediatric high grade glioma 1.100 1.6e-03
primitive neuroectodermal tumor 1.800 2.1e-02
psoriasis -1.400 3.2e-04

Gene RIF (4)

AA Sequence

MSRSGAAAEKADSRQRPQMKVNEYKENQNIAYVSLRPAQTTVLIKTAKVYLAPFSLSNYQLDQLMCPKSL      1 - 70
SEKNSNNEVACKKTKIKKTCRRIIPPKMKNTSSKAESTLQNSSSAVHTESNKLQPKRTADAMNLSVDVES     71 - 140
SQDGDSDEDTTPSLDFSGLSPYERKRLKNISENADFFASLQLSESAARLREMIEKRQPPKSKRKKPKREN    141 - 210
GIGCRRSMRLLKVDPSGVSLPAAPTPPTLVADETPLLPPGPLEMTSENQEDNNERFKGFLHTWAGMSKPS    211 - 280
SKNTEKGLSSIKSYKANLNGMVISEDTVYKVTTGPIFSMALHPSETRTLVAVGAKFGQVGLCDLTQQPKE    281 - 350
DGVYVFHPHSQPVSCLYFSPANPAHILSLSYDGTLRCGDFSRAIFEEVYRNERSSFSSFDFLAEDASTLI    351 - 420
VGHWDGNMSLVDRRTPGTSYEKLTSSSMGKIRTVHVHPVHRQYFITAGLRDTHIYDARRLNSRRSQPLIS    421 - 490
LTEHTKSIASAYFSPLTGNRVVTTCADCNLRIFDSSCISSKIPLLTTIRHNTFTGRWLTRFQAMWDPKQE    491 - 560
DCVIVGSMAHPRRVEIFHETGKRVHSFGGEYLVSVCSINAMHPTRYILAGGNSSGKIHVFMNEKSC        561 - 626
//

Text Mined References (13)

PMID Year Title