Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1963 2.5e-08
group 3 medulloblastoma 4002 9.5e-05
ovarian cancer 8297 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 9.5e-05
ovarian cancer 1.100 1.2e-03
tuberculosis 1.600 2.5e-08

Gene RIF (1)

AA Sequence

MERSGPSEVTGSDASGPDPQLAVTMGFTGFGKKARTFDLEAMFEQTRRTAVERSRKTLEAREKEEEMNRE      1 - 70
KELRRQNEDIEPTSSRSNVVRDCSKSSSRDTSSSESEQSSDSSDDELIGPPLPPKMVGKPVNFMEEDILG     71 - 140
PLPPPLNEEEEEAEEEEEEEEEEENPVHKIPDSHEITLKHGTKTVSALGLDPSGARLVTGGYDYDVKFWD    141 - 210
FAGMDASFKAFRSLQPCECHQIKSLQYSNTGDMILVVSGSSQAKVIDRDGFEVMECIKGDQYIVDMANTK    211 - 280
GHTAMLHTGSWHPKIKGEFMTCSNDATVRTWEVENPKKQKSVFKPRTMQGKKVIPTTCTYSRDGNLIAAA    281 - 350
CQNGSIQIWDRNLTVHPKFHYKQAHDSGTDTSCVTFSYDGNVLASRGGDDSLKLWDIRQFNKPLFSASGL    351 - 420
PTMFPMTDCCFSPDDKLIVTGTSIQRGCGSGKLVFFERRTFQRVYEIDITDASVVRCLWHPKLNQIMVGT    421 - 490
GNGLAKVYYDPNKSQRGAKLCVVKTQRKAKQAETLTQDYIITPHALPMFREPRQRSTRKQLEKDRLDPLK    491 - 560
SHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTDDSNPREAILRHAKAAEDSPYWVSPAYSKTQPK    561 - 630
TMFAQVESDDEEAKNEPEWKKRKI                                                  631 - 654
//

Text Mined References (18)

PMID Year Title