Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.56
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.502 2.4e-03
posterior fossa group B ependymoma 3.200 3.3e-10
non-small cell lung cancer 3.072 1.6e-14
cystic fibrosis 2.600 3.2e-05
psoriasis 2.500 1.0e-08
lung adenocarcinoma 1.900 1.3e-03
nasopharyngeal carcinoma -1.800 3.3e-05
pituitary cancer -1.800 2.1e-04
chronic rhinosinusitis -1.938 3.5e-02

Synonym

Accession Q8TBY9 C9J1W2 Q8IYA3 Q8N898 Q8NDE7
Symbols CaM-IP4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (5)

PMID Text
23514407 WDR66 expression is likely to play an important role in esophageal squamous cell carcinoma growth and invasion as a positive modulator of epithelial-mesenchymal transition.
22552337 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21572414 Indicates that an intronic SNP in the WDR66 gene associates with 2-hydroxyisobutyrate concentrations.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19110211 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDAAEAPREATGENGETEMKEEEEPNPNYKEVEDPQQESKDDTIAWRESQEEERKTGEEEGEEEGKEDK      1 - 70
KIVMEETEEKAGEVQEKEASGIQEETTVEPQEVTASMIRLETQITDSQSITSGIFPKTQRGSKSKLSLQL     71 - 140
EDAETDELLRDLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRDLEPENREEGQ    141 - 210
ERRVSDIQSKAGISRESLVSSTTEDILFQKDKSTPVYPLTMTWSFGWNSSLPVYYIREERQRVLLYVCAH    211 - 280
TAIIYNVFRNNQYHLQGHANIISCLCVSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIM    281 - 350
AMAMTHDAKYLATISDAEVQKVCIWKWTLAVETPACTLELPTEYGVQNYVTFNPTNNKELVSNSKTRAIY    351 - 420
YAWYEERDTLAHSAPLLTEKTFNKLVGKFSQSIFHLNLTQILSATMEGKLVVWDIHRPPSSASTFLGFPY    421 - 490
IKPCKLVHLQKEGITVLTTIDSYIVTGDIKGNIKFYDHTLSIVNWYSHLKLGAIRTLSFSKTPATPPTEK    491 - 560
SNYPPDCTLKGDLFVLRNFIIGTSDAAVYHLTTDGTKLEKLFVEPKDAICAISCHPYQPLIAIGSICGMI    561 - 630
KVWNYENKQYLFSRVFEKGLGVQSLTYNPEGALLGAGFTEGTVYILDAMSLENESPEPFKYSRTSVTHIS    631 - 700
FSHDSQYMATADRSFTVAVYMLVVRNGQRVWEYLARLRSHRKSIRSLLFGVYLDSNEPRLLSLGTDRLLI    701 - 770
EYDLLRSYKDHLEVLDIHHTDQGCYPTCMVWYPPLTRELFLLICNSGYKVKLFNATTKMCRKTLLGPAYG    771 - 840
SPIEQTQVLPVRSMAELQKRYLVFINRDKVGLQILPVDGNPHKTSAIVCHPNGVAGMAVSYDGCYAFTAG    841 - 910
GHDRSVVQWKITLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYFYYSQLRSQGIDTMETRKVSE    911 - 980
HICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPFGNTMSGIHK    981 - 1050
SFEVLGYTNSKGKKAIRREDFLRLLVTKGEHMTEEEMLDCFASLFGLNPEGWKSEPATCSVKGSEICLEE   1051 - 1120
ELPDEITAEIFATEILGLTISEDSGQDGQ                                            1121 - 1149
//

Text Mined References (20)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23514407 2013 Wdr66 is a novel marker for risk stratification and involved in epithelial-mesenchymal transition of esophageal squamous cell carcinoma.
22552337 2012 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21572414 2011 A genome-wide association study of metabolic traits in human urine.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19110211 2009 A genome-wide association study identifies three loci associated with mean platelet volume.
18925368 2008 Diversity of WD-repeat proteins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17967944 2007 A conserved CaM- and radial spoke associated complex mediates regulation of flagellar dynein activity.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11814058 2001 WD-repeat proteins: structure characteristics, biological function, and their involvement in human diseases.
10322433 1999 The WD repeat: a common architecture for diverse functions.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8090199 1994 The ancient regulatory-protein family of WD-repeat proteins.