Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.69
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.28108822732622E-16
non-small cell lung carcinoma 413 1.56686675924034E-8
nasopharyngeal carcinoma 1056 8.18036572198584E-8
lung adenocarcinoma 2714 1.75919656840954E-6
lung carcinoma 2844 3.20972113907818E-4
atypical teratoid / rhabdoid tumor 4369 0.00172511105701394
adrenocortical carcinoma 1427 0.00228379521074444
chronic rhinosinusitis 512 0.0404859573385744

Expression

  Differential Expression (8)

Synonym

Accession Q8IWG1 A8K988 Q96L72 Q96NU4
Symbols DIC3
NYD-SP29

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAPKQKKKTSRGKKRLKPVLAASEDMEPVNMESMGHPEIYPLVLTTKTQEIFNCRIDEDVTDEQPYKLIN      1 - 70
KEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIATEEGKENYLNPPEVPEEQEE     71 - 140
YKEHIPEDVYIYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSDQNASSVKDAY    141 - 210
IECTAYPDKNFTLKQLEKDVGMQVIPQIKDISTQTKWTYPKNATTQYYPREFSEEEKETLKQSKPLVDFL    211 - 280
NNASISVEIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYG    281 - 350
LIAVSVAVRLSFEDRVHFSGKLLLQPSLILFWSFSDPIHPQLMLESPDDIFCFKFCPSDPNIIAGGCING    351 - 420
QIVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSD    421 - 490
TFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQTTEKKKEESIEIPFDVPSTFLHLDLS    491 - 560
WKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLAQSKTEKAEEMNPYHNLESGMANLLKPIDDF    561 - 630
CTKFFVGTEEGEVIYTDWKMEKDPETGRLMSKKPVSHHTIHDGTVHTIQRSPFYNDIILTVGGWNVAIWK    631 - 700
EGVMTGPLLQSCCAPKRYTSGHWSLTRPGVFYIGREDGYIDIWDLLEKTHEPAQSQNICITMITYIKPWI    701 - 770
FSSKQQFIATADYYGTLHILEIPWTLSRPSTNEMASVNHYFEREVKHLEYVEQRKKIREQEKKEMELEMA    771 - 840
KKKVKTYQKSKEQMQAELKMDYESYLELEKTVLINLGLIKVTEKGSYMEVM                       841 - 891
//

Text Mined References (8)

PMID Year Title
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
21953912 2011 A unified taxonomy for ciliary dyneins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.