Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.95
PubTator Score 4.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple myeloma 1327 6.3e-04
ovarian cancer 8491 1.8e-03
glioblastoma 5572 3.2e-03
Waldenstrons macroglobulinemia 764 1.2e-02
acute myeloid leukemia 785 2.1e-02
Disease Target Count Z-score Confidence
Parathyroid carcinoma 5 3.013 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.155 1.2e-02
Multiple myeloma 1.460 6.3e-04
glioblastoma 1.300 3.2e-03
acute myeloid leukemia -1.300 2.1e-02
ovarian cancer 2.000 1.8e-03

Protein-protein Interaction (5)

Gene RIF (1)

PMID Text
22190034 HIV-1 IN is identified to have a physical interaction with WD repeat domain 61 (WDR61) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSV      1 - 70
DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKK     71 - 140
EYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASD    141 - 210
DGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGV    211 - 280
KYNGNGSKIVSVGDDQEIHIYDCPI                                                 281 - 305
//

Text Mined References (17)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21468892 2011 Structure and function of WD40 domain proteins.
21269460 2011 Initial characterization of the human central proteome.
20541477 2010 The PAF complex synergizes with MLL fusion proteins at HOX loci to promote leukemogenesis.
20178742 2010 The human PAF1 complex acts in chromatin transcription elongation both independently and cooperatively with SII/TFIIS.
19952111 2009 DSIF, the Paf1 complex, and Tat-SF1 have nonredundant, cooperative roles in RNA polymerase II elongation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16307923 2005 Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.
16024656 2005 The human PAF complex coordinates transcription with events downstream of RNA synthesis.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.