Property Summary

NCBI Gene PubMed Count 10
PubMed Score 18.29
PubTator Score 4.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 5.5e-05
Multiple myeloma 1332 6.3e-04
glioblastoma 5792 3.2e-03
Waldenstrons macroglobulinemia 765 1.2e-02
acute myeloid leukemia 783 2.1e-02
Disease Target Count Z-score Confidence
Amebiasis 21 3.035 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.300 2.1e-02
glioblastoma 1.300 3.2e-03
Multiple myeloma 1.460 6.3e-04
ovarian cancer -1.700 5.5e-05
Waldenstrons macroglobulinemia 1.155 1.2e-02

Gene RIF (1)

AA Sequence

MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSV      1 - 70
DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKK     71 - 140
EYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASD    141 - 210
DGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGV    211 - 280
KYNGNGSKIVSVGDDQEIHIYDCPI                                                 281 - 305
//

Text Mined References (17)

PMID Year Title