Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.26
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.200 1.1e-02
atypical teratoid / rhabdoid tumor 1.100 1.4e-02
ependymoma 1.200 1.0e-04
glioblastoma 1.100 6.6e-03
group 4 medulloblastoma 1.600 3.0e-05
lung cancer 1.100 1.5e-03
medulloblastoma, large-cell 1.500 6.5e-04
oligodendroglioma 1.400 7.9e-03
osteosarcoma -3.224 6.2e-10
ovarian cancer -1.400 2.9e-05
pancreatic ductal adenocarcinoma liver m... 1.326 8.3e-03
psoriasis -2.800 9.8e-06

Gene RIF (4)

AA Sequence

MDALEDYVWPRATSELILLPVTGLECVGDRLLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRV      1 - 70
RPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFWELWRSGLWNMSDWIWDARWLEGNIALALGHNSVVL     71 - 140
YDPVVGCILQEVPCTDRCTLSSACLIGDAWKELTIVAGAVSNQLLVWYPATALADNKPVAPDRRISGHVG    141 - 210
IIFSMSYLESKGLLATASEDRSVRIWKVGDLRVPGGRVQNIGHCFGHSARVWQVKLLENYLISAGEDCVC    211 - 280
LVWSHEGEILQAFRGHQGRGIRAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGT    281 - 350
LKAVTLAGSWRLLAVTDTGALYLYDVEVKCWEQLLEDKHFQSYCLLEAAPGPEGFGLCAMANGEGRVKVV    351 - 420
PINTPTAAVDQTLFPGKVHSLSWALRGYEELLLLASGPGGVVACLEISAAPSGKAIFVKERCRYLLPPSK    421 - 490
QRWHTCSAFLPPGDFLVCGDRRGSVLLFPSRPGLLKDPGVGGKARAGAGAPVVGSGSSGGGNAFTGLGPV    491 - 560
STLPSLHGKQGVTSVTCHGGYVYTTGRDGAYYQLFVRDGQLQPVLRQKSCRGMNWLAGLRIVPDGSMVIL    561 - 630
GFHANEFVVWNPRSHEKLHIVNCGGGHRSWAFSDTEAAMAFAYLKDGDVMLYRALGGCTRPHVILREGLH    631 - 700
GREITCVKRVGTITLGPEYGVPSFMQPDDLEPGSEGPDLTDIVITCSEDTTVCVLALPTTTGSAHALTAV    701 - 770
CNHISSVRAVAVWGIGTPGGPQDPQPGLTAHVVSAGGRAEMHCFSIMVTPDPSTPSRLACHVMHLSSHRL    771 - 840
DEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHK    841 - 910
RCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHS    911 - 980
CGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTG    981 - 1050
LKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWY   1051 - 1120
D//

Text Mined References (20)

PMID Year Title