Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.500 2.1e-04
Astrocytoma, Pilocytic 1.100 1.3e-04
atypical teratoid / rhabdoid tumor 2.000 4.9e-12
ependymoma 1.400 6.4e-13
glioblastoma 1.400 4.5e-09
group 3 medulloblastoma 1.300 1.2e-02
lung cancer 1.600 9.6e-03
malignant mesothelioma 1.500 1.2e-06
medulloblastoma, large-cell 1.800 5.8e-05
primitive neuroectodermal tumor 1.800 1.2e-05
tuberculosis -1.200 1.3e-04

AA Sequence

MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGA      1 - 70
YDGKYEKTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLI     71 - 140
ISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDN    141 - 210
PPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVY    211 - 280
IWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLWMSNH                        281 - 330
//

Text Mined References (7)

PMID Year Title