Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.500 1.2e-06
posterior fossa group B ependymoma 1.500 3.0e-09
glioblastoma 1.700 8.0e-07
medulloblastoma 2.100 1.1e-08
atypical teratoid / rhabdoid tumor 2.000 4.9e-12
medulloblastoma, large-cell 1.800 5.8e-05
primitive neuroectodermal tumor 1.800 1.2e-05
tuberculosis and treatment for 6 months -1.500 2.0e-06
lung cancer 1.600 9.6e-03
adult high grade glioma 1.500 2.1e-04
pilocytic astrocytoma 1.100 1.1e-04

Synonym

Accession Q86VZ2 B2RCM9 Q9NUL4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGA      1 - 70
YDGKYEKTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLI     71 - 140
ISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDN    141 - 210
PPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVY    211 - 280
IWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLWMSNH                        281 - 330
//

Text Mined References (7)

PMID Year Title
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10369878 1999 Extensive gene order differences within regions of conserved synteny between the Fugu and human genomes: implications for chromosomal evolution and the cloning of disease genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.