Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.36
PubTator Score 26.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 2.3e-04
ovarian cancer -2.000 5.3e-07

Gene RIF (12)

AA Sequence

MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGS      1 - 70
SPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDT     71 - 140
RDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSAPFTINAHQSDIACVSLNQPGTVVASA    141 - 210
SQKGTLIRLFDTQSKEKLVELRRGTDPATLYCINFSHDSSFLCASSDKGTVHIFALKDTRLNRRSALARV    211 - 280
GKVGPMIGQYVDSQWSLASFTVPAESACICAFGRNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDV    281 - 350
YLDICDDDDF                                                                351 - 360
//

Text Mined References (21)

PMID Year Title