Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.44
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
colon cancer 1475 2.0e-06
acute quadriplegic myopathy 1157 2.1e-06
lung cancer 4473 7.7e-06
osteosarcoma 7933 1.6e-05
ovarian cancer 8491 3.3e-04
psoriasis 6685 3.4e-04
gastric carcinoma 832 7.8e-03
group 3 medulloblastoma 2254 1.6e-02
Disease Target Count Z-score Confidence
Treacher Collins syndrome 29 3.848 1.9

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.000 3.4e-04
osteosarcoma -1.937 1.6e-05
acute quadriplegic myopathy 1.107 2.1e-06
lung cancer 2.000 7.7e-06
colon cancer 1.600 2.0e-06
group 3 medulloblastoma 1.200 1.6e-02
gastric carcinoma 1.200 7.8e-03
ovarian cancer 1.400 3.3e-04

AA Sequence

MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPA      1 - 70
RLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGC     71 - 140
LYSCSDDKHIVEWNVQTCKVKCKWKGDNSSVSSLCISPDGKMLLSAGRTIKLWVLETKEVYRHFTGHATP    141 - 210
VSSLMFTTIRPPNESQPFDGITGLYFLSGAVHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSEN    211 - 280
KEEPVKLAVVCRDGQVHLFEHILNGYCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLV    281 - 350
YGSWFQPTIERVALNSREPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPAPP    351 - 420
QTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLNKVLQTRNVNLI    421 - 490
KKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLSTLPDLVPQLGTLYQLMESRVK    491 - 560
TFQKLSHLHGKLILLITQVTASEKTKGATSPGQKAKLVYEEESSEEESDDEIADKDSEDNWDEDEEESES    561 - 630
EKDEDVEEEDEDAEGKDEENGEDRDTASEKELNGDSDLDPENESEEE                           631 - 677
//

Text Mined References (20)

PMID Year Title
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24754225 2014 Dynamics of WD-repeat containing proteins in SSU processome components.
24219289 2013 Interaction, mobility, and phosphorylation of human orthologues of WD repeat-containing components of the yeast SSU processome t-UTP sub-complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916032 2012 NOL11, implicated in the pathogenesis of North American Indian childhood cirrhosis, is required for pre-rRNA transcription and processing.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17699751 2007 Recruitment of factors linking transcription and processing of pre-rRNA to NOR chromatin is UBF-dependent and occurs independent of transcription in human cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.