Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.34
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 2.1e-02
osteosarcoma -2.415 4.7e-04
medulloblastoma, large-cell 1.200 2.4e-03
acute quadriplegic myopathy 1.299 1.5e-07
Atopic dermatitis 1.300 4.6e-04
psoriasis 1.400 8.2e-31
invasive ductal carcinoma 1.100 1.6e-02
ovarian cancer 2.200 2.0e-06

Gene RIF (2)

PMID Text
26751069 regulates FEN1's potential DNA cleavage threat near the site of replication
26416026 Combined autozygome/exome analysis revealed a novel missense mutation in WDR4 as the likely causal variant of Primordial dwarfism

AA Sequence

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFS      1 - 70
KSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRL     71 - 140
ELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGD    141 - 210
GTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQL    211 - 280
VYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS    281 - 350
AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC            351 - 412
//

Text Mined References (21)

PMID Year Title
26751069 2016 Wuho Is a New Member in Maintaining Genome Stability through its Interaction with Flap Endonuclease 1.
26416026 2015 Mutation in WDR4 impairs tRNA m(7)G46 methylation and causes a distinct form of microcephalic primordial dwarfism.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15861136 2005 The tRNA methylase METTL1 is phosphorylated and inactivated by PKB and RSK in vitro and in cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403464 2002 Two proteins that form a complex are required for 7-methylguanosine modification of yeast tRNA.
10950928 2000 Isolation and characterization of a human chromosome 21q22.3 gene (WDR4) and its mouse homologue that code for a WD-repeat protein.
10830953 2000 The DNA sequence of human chromosome 21.