Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.400 4.5e-14
diabetes mellitus 1.200 1.3e-03
nasopharyngeal carcinoma -1.500 1.7e-07
lung carcinoma -1.400 7.5e-04

AA Sequence

CAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT                                        281 - 314

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.