Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.79
PubTator Score 6.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Thyroid cancer 25 3.066 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.100 5.0e-06
pancreatic cancer 1.100 2.5e-04
lung cancer 1.800 1.7e-05
colon cancer 1.200 1.1e-03
breast carcinoma 1.200 1.4e-02
diabetes mellitus -1.100 5.7e-03
group 3 medulloblastoma 1.200 1.5e-03
pancreatic carcinoma 1.100 2.5e-04
ovarian cancer 1.300 7.7e-03

Synonym

Accession Q9UNX4
Symbols DIP2
UTP12

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (5)

PMID Text
23049746 WDR3 can modulate genome stability in thyroid cancer patients.
22174317 HIV-1 Rev interacting protein, WD repeat domain 3 (WDR3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with WDR3 is increased by RRE
20578902 results indicate for the first time that WDR3 is a risk factor to thyroid cancer, suggesting its implication in the etiology of thyroid cancer
20578902 Observational study of gene-disease association. (HuGE Navigator)
20392698 WDR3 has an essential function in 40 S ribosomal subunit synthesis and in ribosomal stress signaling to p53-mediated regulation of cell cycle progression in cancer cells

AA Sequence

MGLTKQYLRYVASAVFGVIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKILILQGLKQEVTC      1 - 70
LCPSPDGLHLAVGYEDGSIRIFSLLSGEGNVTFNGHKAAITTLKYDQLGGRLASGSKDTDIIVWDVINES     71 - 140
GLYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDTQHCFKTMVGHRTEVWGLVLLSEEKRLITGA    141 - 210
SDSELRVWDIAYLQEIEDPEEPDPKKIKGSSPGIQDTLEAEDGAFETDEAPEDRILSCRKAGSIMREGRD    211 - 280
RVVNLAVDKTGRILACHGTDSVLELFCILSKKEIQKKMDKKMKKARKKAKLHSSKGEEEDPEVNVEMSLQ    281 - 350
DEIQRVTNIKTSAKIKSFDLIHSPHGELKAVFLLQNNLVELYSLNPSLPTPQPVRTSRITIGGHRSDVRT    351 - 420
LSFSSDNIAVLSAAADSIKIWNRSTLQCIRTMTCEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLE    421 - 490
TIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSVKQTRTLQLDEDVLCVSYSPN    491 - 560
QKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGDCHKSLF    561 - 630
AHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLR    631 - 700
LWERTREPLILEEEREMEREAEYEESVAKEDQPAVPGETQGDSYFTGKKTIETVKAAERIMEAIELYREE    701 - 770
TAKMKEHKAICKAAGKEVPLPSNPILMAYGSISPSAYVLEIFKGIKSSELEESLLVLPFSYVPDILKLFN    771 - 840
EFIQLGSDVELICRCLFFLLRIHFGQITSNQMLVPVIEKLRETTISKVSQVRDVIGFNMAGLDYLKRECE    841 - 910
AKSEVMFFADATSHLEEKKRKRKKREKLILTLT                                         911 - 943
//

Text Mined References (22)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23049746 2012 Possible role of the WDR3 gene on genome stability in thyroid cancer patients.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20578902 2010 WDR3 gene haplotype is associated with thyroid cancer risk in a Spanish population.
20392698 2010 Ribosomal 18 S RNA processing by the IGF-I-responsive WDR3 protein is integrated with p53 function in cancer cell proliferation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15635413 2005 Nucleolar proteome dynamics.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11790298 2002 Directed proteomic analysis of the human nucleolus.
10395803 1999 Cloning and expression analysis of a novel WD repeat gene, WDR3, mapping to 1p12-p13.
9628821 1998 Identification of sequence-tagged transcripts differentially expressed within the human hematopoietic hierarchy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.