Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.27
PubTator Score 8.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.366 2.6e-03
esophageal adenocarcinoma -1.300 2.7e-02
glioblastoma 1.100 1.9e-02
intraductal papillary-mucinous carcinoma... 1.300 1.6e-03
subependymal giant cell astrocytoma 1.283 2.4e-02
spina bifida -1.098 4.3e-02
Pick disease -1.300 2.6e-05
progressive supranuclear palsy -1.100 1.5e-02
ovarian cancer 2.300 4.3e-05

Gene RIF (6)

PMID Text
25918994 The WDR26 gene was differentially methylated in monozygotic twins discordant for depressive disorder.
23625927 WDR26 functions as a scaffolding protein to promote PLCbeta2 membrane translocation and interaction with Gbetagamma, thereby enhancing PLCbeta2 activation in leukocytes.
22065575 WDR26 is a novel Gbetagamma-binding protein that is required for the efficacy of Gbetagamma signaling and leukocyte migration
20171191 these data suggest that MIP2 may participate in the progression of cell proliferation in H9c2 cells.
19446606 The results of this study indicated that WDR26 was up-regulated by oxidative stress and played a key role in H2O2-induced SH-SY5Y cell death, which may be mediated by the down-regulation of AP-1 transcriptional activity.
15378603 WDR26 may act as a negative regulator in MAPK signaling pathway and play an important role in cell signal transduction.

AA Sequence

MQANGAGGGGGGGGGGGGGGGGGGGQGQTPELACLSAQNGESSPSSSSSAGDLAHANGLLPSAPSAASNN      1 - 70
SNSLNVNNGVPGGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRLSQSDEDVIRLIGQHLNGLGL     71 - 140
NQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDKAENDLNELKPLVHSPHAIVVRGALEISQTLLGIIVR    141 - 210
MKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRS    211 - 280
KLLDKLQTYLPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSRRQFPCYTQQI    281 - 350
LTEHCNEVWFCKFSNDGTKLATGSKDTTVIIWQVDPDTHLLKLLKTLEGHAYGVSYIAWSPDDNYLVACG    351 - 420
PDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC    421 - 490
LWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRLALLNVATQGVHLWDLQDRVL    491 - 560
VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHKRSELPIAELTGHTRTVNCVSWNPQIPSMMA    561 - 630
SASDDGTVRIWGPAPFIDHQNIEEECSSMDS                                           631 - 661
//

Text Mined References (32)

PMID Year Title
27098453 2016 WDR26 is a new partner of Axin1 in the canonical Wnt signaling pathway.
25918994 2015 Genome-wide methylation study on depression: differential methylation and variable methylation in monozygotic twins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23625927 2013 WDR26 functions as a scaffolding protein to promote G??-mediated phospholipase C ?2 (PLC?2) activation in leukocytes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22065575 2011 The WD40 repeat protein WDR26 binds G?? and promotes G??-dependent signal transduction and leukocyte migration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
20171191 2010 Overexpression of MIP2, a novel WD-repeat protein, promotes proliferation of H9c2 cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19446606 2009 A novel WD-40 repeat protein WDR26 suppresses H2O2-induced cell death in neural cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18587224 2008 [The possible curative therapy for rheumatoid arthritis--EBV infection control gene SAP and its application].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17785286 2007 SLAM-associated protein solves a mystery of autoimmunity.
17643931 2007 SAP discovery: the sword edges--beneficial and harmful.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17289546 2007 What is after cytokine-blocking therapy, a novel therapeutic target--synovial Epstein-Barr virus for rheumatoid arthritis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15722257 2005 Epstein-Barr virus etiology in rheumatoid synovitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378603 2004 WDR26: a novel Gbeta-like protein, suppresses MAPK signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
11282995 2001 Decreased expression of signaling lymphocytic-activation molecule-associated protein (SAP) transcripts in T cells from patients with rheumatoid arthritis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.