Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.35
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell -1.100 3.0e-04

Synonym

Accession Q64LD2 A8K7E5 Q6NVV6 Q86TQ4 Q9BTK5
Symbols C14orf67

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

 Compartment GO Term (1)

AA Sequence

MTARTLSLMASLVAYDDSDSEAETEHAGSFNATGQQKDTSGVARPPGQDFASGTLDVPKAGAQPTKHGSC      1 - 70
EDPGGYRLPLAQLGRSDWGSCPSQRLQWPGKEPQVTFPIKEPSCSSLWTSHVPASHMPLAAARFKQVKLS     71 - 140
RNFPKSSFHAQSESETVGKNGSSFQKKKCEDCVVPYTPRRLRQRQALSTETGKGKDVEPQGPPAGRAPAP    141 - 210
LYVGPGVSEFIQPYLNSHYKETTVPRKVLFHLRGHRGPVNTIQWCPVLSKSHMLLSTSMDKTFKVWNAVD    211 - 280
SGHCLQTYSLHTEAVRAARWAPCGRRILSGGFDFALHLTDLETGTQLFSGRSDFRITTLKFHPKDHNIFL    281 - 350
CGGFSSEMKAWDIRTGKVMRSYKATIQQTLDILFLREGSEFLSSTDASTRDSADRTIIAWDFRTSAKISN    351 - 420
QIFHERFTCPSLALHPREPVFLAQTNGNYLALFSTVWPYRMSRRRRYEGHKVEGYSVGCECSPGGDLLVT    421 - 490
GSADGRVLMYSFRTASRACTLQGHTQACVGTTYHPVLPSVLATCSWGGDMKIWH                    491 - 544
//

Text Mined References (8)

PMID Year Title