Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.02
PubTator Score 0.55

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96S15 A2IDB8 D3DU59 Q96GC7 Q9H0B7
Symbols JFP7
C16orf21

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MGKKRTTSGEGRERQRLPARRFRTTSPAALRADSVDGGSLLAPLLGLTDRAFSDCPDLADGAMEKMSRVT      1 - 70
TALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCA     71 - 140
DVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCF    141 - 210
DLRRKDSVSTFSGEATEAGPREWAMAGCVPILPVLSCRILRLHHSFAHGPMQDAESTANDARESWGCPLY    211 - 280
PLGLCSGPQAGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDR    281 - 350
GWLATGGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPA    351 - 420
AMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLV    421 - 490
AAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELC    491 - 560
DHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRL    561 - 630
DRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQE    631 - 700
AFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDM    701 - 770
LHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQ    771 - 840
ASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCP    841 - 910
AGCGHLCEYS                                                                911 - 920
//

Text Mined References (21)

PMID Year Title
27487210 2016 Mechanism of arginine sensing by CASTOR1 upstream of mTORC1.
27166823 2016 The GATOR2 Component Wdr24 Regulates TORC1 Activity and Lysosome Function.
26972053 2016 The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.
26586190 2016 Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway.
26449471 2016 Sestrin2 is a leucine sensor for the mTORC1 pathway.
25457612 2014 Sestrins inhibit mTORC1 kinase activation through the GATOR complex.
25416956 2014 A proteome-scale map of the human interactome network.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
11076863 2000 DNA cloning using in vitro site-specific recombination.