Property Summary

NCBI Gene PubMed Count 18
PubMed Score 20.46
PubTator Score 6.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 2.3e-04
glioblastoma 1.200 1.6e-03
lung cancer 2.700 4.2e-05
non-small cell lung cancer 1.453 6.8e-24
osteosarcoma 1.249 6.6e-03
ovarian cancer 1.300 8.1e-04
psoriasis 2.200 1.1e-04
Waldenstrons macroglobulinemia 1.202 1.6e-03

Gene RIF (7)

AA Sequence

MAQLQTRFYTDNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMPLDKHM      1 - 70
EMENISSEEVVEIEYVEKYTAPQPEQCMFHDDWISSIKGAEEWILTGSYDKTSRIWSLEGKSIMTIVGHT     71 - 140
DVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWD    141 - 210
KMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQLGLTRTPIVTLSGHMEAVSSVLWSDAEEICSASWDHTI    211 - 280
RVWDVESGSLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKW    281 - 350
SPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH    351 - 420
VGA                                                                       421 - 423
//

Text Mined References (24)

PMID Year Title