Property Summary

NCBI Gene PubMed Count 26
PubMed Score 43.30
PubTator Score 22.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
pancreatic cancer -1.500 3.0e-02
malignant mesothelioma -3.000 5.2e-07
ependymoma 1.600 1.1e-05
oligodendroglioma 1.200 7.5e-03
esophageal adenocarcinoma -1.200 2.4e-02
psoriasis 2.000 1.8e-05
osteosarcoma 1.959 1.6e-03
glioblastoma 2.000 6.5e-03
astrocytoma 1.500 4.8e-03
atypical teratoid / rhabdoid tumor 2.100 5.1e-04
medulloblastoma 1.200 1.4e-02
medulloblastoma, large-cell 1.300 1.6e-03
primary pancreatic ductal adenocarcinoma 1.610 3.5e-04
breast carcinoma 1.900 3.5e-03
diabetes mellitus -1.100 1.8e-03
pediatric high grade glioma 1.500 1.1e-02
pancreatic carcinoma -1.500 3.0e-02
Polycystic Ovary Syndrome -1.417 4.6e-03
ovarian cancer 2.000 1.5e-05

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (10)

PMID Text
25792565 Demonstrate a previously unanticipated role of Aip1 in regulating the structure and remodeling of intestinal epithelial junctions and early steps of epithelial morphogenesis.
24516586 When maternal environmental tobacco smoke was considered, fifteen of 135 single nucleotide polymorphism (SNPs) mapping to SLC2A9 and 9 of 59 SNPs in WDR1 gave P values approaching genome-wide significance.
23707566 WD repeat-containing protein 1 was confirmed as being significantly overexpressed in interstitial fluid from ovarian carcinomas compared to healthy ovarian tissue.
23293323 Studies suggest that vascular endothelial growth factor may be responsible for upregulated P-glycoprotein expression.
23215816 Data suggest that anti-WD repeat domain 1 (WDR1) antibody could be applied for serological screening of papillary thyroid carcinoma (PTC) and undifferentiated thyroid carcinoma (UTC), and could be an efficient and inexpensive biomarker.
20631256 The QKI RNA-binding proteins regulate oligodendrocyte differentiation by modulating the expression of AIP-1.
19818632 Studies indicate that CUL4 uses a large beta-propeller protein, DDB1, as a linker to interact with a subset of WD40 proteins.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18494608 Data indicates that Aip1 plays an important role in directional cell migration by restricting the stimulus-induced membrane protrusion to one direction via promoting cofilin activity.
15629458 AIP1/WDR1 could abort the severing/disassembly activity somewhat still carried out due to phosphorylated ADF/cofilin

AA Sequence

MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSG      1 - 70
FYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVG     71 - 140
EITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASAD    141 - 210
GQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLD    211 - 280
QQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWD    281 - 350
SETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGY    351 - 420
AVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG    421 - 490
PVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWT    491 - 560
LSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY                            561 - 606
//

Text Mined References (35)

PMID Year Title
25792565 2015 Actin-interacting protein 1 controls assembly and permeability of intestinal epithelial apical junctions.
24516586 2014 Evidence of gene-environment interaction for two genes on chromosome 4 and environmental tobacco smoke in controlling the risk of nonsyndromic cleft palate.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23707566 2013 Increased WD-repeat containing protein 1 in interstitial fluid from ovarian carcinomas shown by comparative proteomic analysis of malignant and healthy gynecological tissue.
23293323 2013 Tumour endothelial cells acquire drug resistance in a tumour microenvironment.
23215816 2013 Autoantibody against WD repeat domain 1 is a novel serological biomarker for screening of thyroid neoplasia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22721921 Proteomic analysis of podosome fractions from macrophages reveals similarities to spreading initiation centres.
22229870 2012 Genome-wide association of serum uric acid concentration: replication of sequence variants in an island population of the Adriatic coast of Croatia.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21688384 2011 Genome-wide association analysis of age at onset in schizophrenia in a European-American sample.
21269460 2011 Initial characterization of the human central proteome.
20631256 2010 The QKI-6 RNA binding protein regulates actin-interacting protein-1 mRNA stability during oligodendrocyte differentiation.
19818632 2009 CRL4s: the CUL4-RING E3 ubiquitin ligases.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18494608 2008 Critical roles of actin-interacting protein 1 in cytokinesis and chemotactic migration of mammalian cells.
18179892 2008 Genome-wide association study identifies genes for biomarkers of cardiovascular disease: serum urate and dyslipidemia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15629458 2005 AIP1/WDR1 supports mitotic cell rounding.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10366597 1999 Aip1p interacts with cofilin to disassemble actin filaments.
10036186 1999 A gene upregulated in the acoustically damaged chick basilar papilla encodes a novel WD40 repeat protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.