Property Summary

NCBI Gene PubMed Count 24
PubMed Score 193.01
PubTator Score 18776.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 2.200 8.4e-07
psoriasis -1.700 3.7e-04
osteosarcoma -1.848 7.0e-04
glioblastoma 2.100 6.4e-05
group 3 medulloblastoma 2.100 9.1e-06
atypical teratoid / rhabdoid tumor 2.000 6.9e-06
medulloblastoma, large-cell 2.300 1.8e-06
primitive neuroectodermal tumor 1.900 3.0e-05
non-small cell lung cancer 1.180 2.5e-17
intraductal papillary-mucinous carcinoma... 1.400 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.700 9.9e-04
lung cancer 3.500 4.3e-06
colon cancer 1.400 1.2e-02
active Crohn's disease 1.122 1.1e-02
Breast cancer 2.800 2.8e-02
pediatric high grade glioma 1.700 4.9e-06
lung adenocarcinoma 1.100 9.7e-06
spina bifida -1.016 4.4e-02
ovarian cancer 1.100 4.7e-04

Gene RIF (14)

PMID Text
26082189 And-1 coordinates with Claspin for efficient Chk1 activation in response to replication stress.
25602958 RecQL4-dependent association of Mcm10 and Ctf4 with replication origins appears to be the first important step controlled by S phase promoting kinases and checkpoint pathways for the initiation of DNA replication in human cells.
24255107 The Ctf4-CMG complex contains a homodimeric Ctf4 that acts as a platform linking polymerase alpha to the monomeric hCMG complex.
23184928 And-1 together with HJURP regulates the assembly of new CENP-A onto centromeres.
23093411 Human And-1 facilitates loading of the MCM2-7 helicase onto chromatin during the assembly of prereplicative complex.
21725360 Data show that And-1 forms a complex with both histone H3 and Gcn5.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20089864 in human cells, hCtf4 plays an essential role in DNA replication and its ability to stimulate the replicative DNA polymerases may contribute to this effect
19805216 Assembly of the Cdc45-Mcm2-7-GINS complex requires the Ctf4/And-1, RecQL4, and Mcm10 proteins.
19439411 AND-1 coordinates multiple cellular events in S phase and G2 phase.
19423540 Observational study of gene-disease association. (HuGE Navigator)
17761813 Mcm10 is required for chromatin loading of And-1.

AA Sequence

MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSCALKSGKLVTA      1 - 70
VSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKIVDVMDSSQQKTFRGHDAPVL     71 - 140
SLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKCNDVINAKSICRLAWQPKSGKLLAIPVEKSV    141 - 210
KLYRRESWSHQFDLSDNFISQTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLA    211 - 280
WHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVEIPSFS    281 - 350
KGIINDDEDDEDLMMASGRPRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPLVTSQRPF    351 - 420
YDGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATHLSNTLNYTIA    421 - 490
DLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICLGQGWAAAATSALLLRLFTIG    491 - 560
GVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLGVQLLELGKKKKQILHGDPLPLTRKSYLAWI    561 - 630
GFSAEGTPCYVDSEGIVRMLNRGLGNTWTPICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPT    631 - 700
LPRPAVAILSFKLPYCQIATEKGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLMKMLA    701 - 770
LSCKLEREFRCVELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEEEEEEDFRKK    771 - 840
LNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKSGAVTFSSQGR    841 - 910
VNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIPKPKPKQASAASYFQ    911 - 980
KRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEG    981 - 1050
MIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQK   1051 - 1120
LSAFAFKQE                                                                1121 - 1129
//

Text Mined References (36)

PMID Year Title
26082189 2015 And-1 coordinates with Claspin for efficient Chk1 activation in response to replication stress.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25602958 2015 RecQL4 is required for the association of Mcm10 and Ctf4 with replication origins in human cells.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24255107 2013 Interaction between human Ctf4 and the Cdc45/Mcm2-7/GINS (CMG) replicative helicase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184928 2013 Acidic nucleoplasmic DNA-binding protein (And-1) controls chromosome congression by regulating the assembly of centromere protein A (CENP-A) at centromeres.
23093411 2012 The involvement of acidic nucleoplasmic DNA-binding protein (And-1) in the regulation of prereplicative complex (pre-RC) assembly in human cells.
22570476 2012 Okazaki fragment processing-independent role for human Dna2 enzyme during DNA replication.
21725360 2012 And-1 is required for the stability of histone acetyltransferase Gcn5.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20089864 2010 Influence of the human cohesion establishment factor Ctf4/AND-1 on DNA replication.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20028748 2010 Activation of WD repeat and high-mobility group box DNA binding protein 1 in pulmonary and esophageal carcinogenesis.
19805216 2009 Assembly of the Cdc45-Mcm2-7-GINS complex in human cells requires the Ctf4/And-1, RecQL4, and Mcm10 proteins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19439411 2009 Roles of human AND-1 in chromosome transactions in S phase.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17761813 2007 Mcm10 and And-1/CTF4 recruit DNA polymerase alpha to chromatin for initiation of DNA replication.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9175701 1997 AND-1, a natural chimeric DNA-binding protein, combines an HMG-box with regulatory WD-repeats.