Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.17
PubTator Score 0.75

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.4e-18
osteosarcoma 7933 2.5e-08


  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.191 2.5e-08
psoriasis -1.500 2.4e-18

AA Sequence

LPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK                                       211 - 245

Text Mined References (6)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
18398435 2008 Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase.
15961456 2005 Identification of nine human-specific frameshift mutations by comparative analysis of the human and the chimpanzee genome sequences.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.