Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 8.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 2.001 3.5e-04
esophageal adenocarcinoma 1.100 2.1e-02
glioblastoma 1.200 2.3e-03
group 3 medulloblastoma 1.100 2.7e-03
lung adenocarcinoma 1.132 2.8e-06
ovarian cancer 1.400 8.6e-06

Gene RIF (7)

PMID Text
26214185 The localization of the TRMT112 protein is determined by WBSCR22, and the WBSCR22-TRMT112 complex is localized in the cell nucleus.
25851604 DIMT1L and WBSCR22-TRMT112 are required for distinct pre-rRNA processing reactions leading to synthesis of 18S rRNA. Ribosome biogenesis requires the presence of the modification enzyme rather than its RNA-modifying catalytic activity.
25525153 The key role of WBSCR22 in 40S subunit biogenesis is independent of its function as an RNA methyltransferase.
25352209 Knockdown of Merm1/Wbscr22 attenuates sensitivity of H460 non-small cell lung cancer cells to SN-38 and 5-FU without alteration to p53 expression levels.
24488492 Merm1 is a novel regulator of chromatin structure affecting GR recruitment and function
24086612 WBSCR22 protein level is decreased in lymphoblastoid cell lines.
11978965 Characterization of two novel genes, WBSCR20 and WBSCR22, deleted in Williams-Beuren syndrome

AA Sequence

MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSY      1 - 70
LSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAK     71 - 140
RLYCFFASLFSVLVRGSRAVLQLYPENSEQLELITTQATKAGFSGGMVVDYPNSAKAKKFYLCLFSGPST    141 - 210
FIPEGLSENQDEVEPRESVFTNERFPLRMSRRGMVRKSRAWVLEKKERHRRQGREVRPDTQYTGRKRKPR    211 - 280
F//

Text Mined References (26)

PMID Year Title
26214185 2015 The Stability of Ribosome Biogenesis Factor WBSCR22 Is Regulated by Interaction with TRMT112 via Ubiquitin-Proteasome Pathway.
25851604 2015 The human 18S rRNA base methyltransferases DIMT1L and WBSCR22-TRMT112 but not rRNA modification are required for ribosome biogenesis.
25525153 2015 WBSCR22/Merm1 is required for late nuclear pre-ribosomal RNA processing and mediates N7-methylation of G1639 in human 18S rRNA.
25352209 2015 Knockdown of Merm1/Wbscr22 attenuates sensitivity of H460 non-small cell lung cancer cells to SN-38 and 5-FU without alteration to p53 expression levels.
24488492 2014 The methyltransferase WBSCR22/Merm1 enhances glucocorticoid receptor function and is regulated in lung inflammation and cancer.
24086612 2013 The human WBSCR22 protein is involved in the biogenesis of the 40S ribosomal subunits in mammalian cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21148752 2011 The novel metastasis promoter Merm1/Wbscr22 enhances tumor cell survival in the vasculature by suppressing Zac1/p53-dependent apoptosis.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15635413 2005 Nucleolar proteome dynamics.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12073013 2002 Identification of additional transcripts in the Williams-Beuren syndrome critical region.
11978965 2001 Characterization of two novel genes, WBSCR20 and WBSCR22, deleted in Williams-Beuren syndrome.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.