Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.33
PubTator Score 5.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 4.1e-02
oligodendroglioma -1.300 5.0e-02
osteosarcoma -1.438 2.0e-03
glioblastoma -1.200 1.0e-04
medulloblastoma, large-cell -1.200 2.6e-03
intraductal papillary-mucinous adenoma (... 1.400 1.7e-02
adult high grade glioma -1.100 1.2e-03
spina bifida -1.026 4.9e-02
gastric carcinoma 1.100 2.2e-02
ductal carcinoma in situ -1.100 3.4e-04
invasive ductal carcinoma -1.400 5.0e-04
ovarian cancer 1.800 2.7e-07
dermatomyositis 1.200 8.5e-04

Gene RIF (3)

PMID Text
21917930 formin-binding protein 21 (FBP21)-tandem-WW domain binding fosters protein recognition in the pre-spliceosome
19592703 analysis of the Structure and function of the two tandem WW domains of the pre-mRNA splicing factor FBP21 (formin-binding protein 21)
18854154 Knockdown of WW domain binding protein 4 (formin binding protein 21, WBP4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEA      1 - 70
AALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYY     71 - 140
YDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVN    141 - 210
ENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGS    211 - 280
NEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMAD    281 - 350
GVAPVFKKRRTENGKSRNLRQRGDDQ                                                351 - 376
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21917930 2011 Multivalent binding of formin-binding protein 21 (FBP21)-tandem-WW domains fosters protein recognition in the pre-spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19592703 2009 Structure and function of the two tandem WW domains of the pre-mRNA splicing factor FBP21 (formin-binding protein 21).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16055720 2005 WW domains provide a platform for the assembly of multiprotein networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10748127 2000 Arginine methylation inhibits the binding of proline-rich ligands to Src homology 3, but not WW, domains.
9724750 1998 WW domain-mediated interactions reveal a spliceosome-associated protein that binds a third class of proline-rich motif: the proline glycine and methionine-rich motif.
8605874 1996 Formin binding proteins bear WWP/WW domains that bind proline-rich peptides and functionally resemble SH3 domains.