Property Summary

NCBI Gene PubMed Count 13
PubMed Score 89.43
PubTator Score 46.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.200 1.9e-10
pituitary cancer 1.300 4.0e-03

Gene RIF (7)

AA Sequence

MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPM      1 - 70
LSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLMVKAASAAARGF     71 - 140
PLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGY    141 - 210
RASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGS    211 - 280
GARPQESTAAQAPENEASLPSASSSQVHS                                             281 - 309
//

Text Mined References (16)

PMID Year Title