Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.30
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MARASSGNGSEEAWGALRAPQQQLRELCPGVNNQPYLCESGHCCGETGCCTYYYELWWFWLLWTVLILFS      1 - 70
CCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPFPTGSLLDLRFLSTFKPPAYEDVVHRPGTPPPP     71 - 140
YTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTG    141 - 210
DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP               211 - 269
//

Text Mined References (11)

PMID Year Title