Property Summary

NCBI Gene PubMed Count 116
PubMed Score 254.70
PubTator Score 180.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.148 5.1e-04
astrocytic glioma 1.100 1.4e-02
atypical teratoid / rhabdoid tumor -1.300 6.0e-03
Breast cancer 2.300 2.8e-02
colon cancer -1.100 1.6e-03
medulloblastoma -1.100 1.7e-02
medulloblastoma, large-cell -2.000 1.9e-03
osteosarcoma 2.017 2.6e-04
ovarian cancer -1.500 8.3e-05
periodontitis -1.100 9.2e-17
psoriasis 1.100 2.5e-03
Rheumatoid arthritis 1.900 1.4e-03
spina bifida -1.663 3.6e-02

Protein-protein Interaction (9)

Gene RIF (52)

AA Sequence

MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKD      1 - 70
NPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGR     71 - 140
RQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQ    141 - 210
HIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPP    211 - 280
PPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPAL    281 - 350
PSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLK    351 - 420
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDED    421 - 490
EDDEEDFEDDDEWED                                                           491 - 505
//

Text Mined References (129)

PMID Year Title