Property Summary

NCBI Gene PubMed Count 106
PubMed Score 243.61
PubTator Score 180.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.900 1.4e-03
astrocytic glioma 1.100 1.4e-02
psoriasis 1.100 2.5e-03
osteosarcoma 2.017 2.6e-04
periodontitis -1.100 9.2e-17
atypical teratoid / rhabdoid tumor -1.300 6.0e-03
medulloblastoma -1.100 1.7e-02
medulloblastoma, large-cell -2.000 1.9e-03
adrenocortical carcinoma 1.148 5.1e-04
colon cancer -1.100 1.6e-03
Breast cancer 2.300 2.8e-02
spina bifida -1.663 3.6e-02
ovarian cancer 3.300 4.3e-06

 GO Function (1)

 GWAS Trait (1)

Gene RIF (47)

PMID Text
26986510 the Cdc42/Nwasp/stress fibers/YAP signal pathway may potentially play an important role in regulating podocyte apoptosis. Maintaining necessary Cdc42 would be one potent way to prevent proteinuria kidney diseases.
26554011 Nck was the most potent activator of N-WASP-driven actin assembly.
26506240 Low GAS7C increases cancer cell motility by promoting N-WASP/FAK/F-actin cytoskeleton dynamics. It also enhances beta-catenin stability via hnRNP U/beta-TrCP complex formation.
26463123 This suggests that N-WASP's failure to compensate for WASP in rescuing chemotaxis could be due to the absence of this I30 region.
26305187 RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein.
26070569 our results reveal a novel role for N-WASP in remodeling EC junctions, which is critical for monolayer integrity and function.
25482634 Tir-Intimin interaction recruits the Nck adaptor to a Tir tyrosine phosphorylated residue where it activates neural Wiskott-Aldrich syndrome protein (N-WASP).
25262827 These results support a role for N-WASP in amphiphysin-2-dependent nuclear positioning and triad organization and in centronuclear myopathy and myotonic dystrophy pathophysiology.
24385601 PC1 modulates actin cytoskeleton rearrangements and directional cell migration through the Pacsin 2/N-Wasp complex.
24284073 Our observations suggest that ITSN1 is an important general regulator of Cdc42-, Nck- and N-WASP-dependent actin polymerisation
24069415 c-Src and NWASP play key roles in mediating the molecular pathogenesis of low oxygen-induced accelerated brain invasion by gliomas.
23760605 A gain-of-function approach for miR-142-3p revealed a down-regulation of N-Wasp expression accompanied by a decrease of mycobacteria intake, while a loss-of-function approach yielded the reciprocal increase of the phagocytosis process.
23690407 endocytosis by endothelial cells may represent a means of traversal of the blood vessel wall by yeast during disseminated candidiasis, and N-WASP may play a key role in the process.
23549080 NWASP activation by mycolactone underpins Buruli ulcer formation via modulation of the actin cytoskeleton.
23273897 N-WASP has a crucial proinvasive role in driving Arp2/3 complex-mediated actin assembly in cooperation with FAK at invasive cell edges, but WRC depletion can promote 3D cell motility.
23212915 Neural Wiskott-Aldrich syndrome protein (N-WASP)-mediated p120-catenin interaction with Arp2-Actin complex stabilizes endothelial adherens junctions.
22585739 study describes that both N-WASp and WASp participate in the inhibition of NK-cell chemotaxis in response to NKG2D WASp engagement, and that this effect is not dependent on the regulation of F-actin dynamics
22559840 Study portrays a role for Claudin-5 in cell motility involving the N-WASP signalling cascade indicating a possible role for Claudin-5 in the metastasis of human breast cancer.
21785420 N-WASP-WIRE serves as an integrator that couples actin nucleation with the subsequent steps of filament stabilization and organization necessary for zonula adherens integrity.
21769917 results indicate that by mediating intensive F-actin accumulation at the sites of cell infiltration, WAVE2, N-WASP, and Mena are crucial for PI3K-dependent cell invasion induced by PDGF
21677511 N-WASP assists in the recruitment and localization of Tuba to the cell junction.
21610097 Perturbation of N-WASP-CK2 complex function showed that N-WASP controls the presence of F-actin at clathrin-coated structures. N-WASP-CK2 complex integrates in a single circuit different activities contributing to CME.
21533546 N-WASP plays a role in efficient assembly of kinetochores and attachment of microtubules to chromosomes, which is essential for accurate chromosome congression and segregation
20880986 Recruitment of FAK and N-WASP is necessary for cell migration and invasion induced by 17beta-estradiol in breast cancer cells.
20730103 Cdc42 may influence endocytic membrane trafficking by regulating the formation and activity of the Toca-1/N-WASP complex.
20678498 Cdc42 regulates the activity of IRSp53 by regulating the IRSp53-WIRE interaction as well as localization of the complex to plasma membrane to generate filopodia.
20146487 Arg promotes actin-based protrusions in response to extracellular stimuli through phosphorylation of and physical interactions with N-WASp.
20095995 CFL1 and N-WASP may play an important role in the tumorigenesis of ESCC, and to be the candidate novel biomarkers for the diagnosis and prognosis of esophageal squamous cell carcinoma.
19262673 the exchange rate of N-WASP controls the rate of ARP2/3-complex-dependent actin-based motility by regulating the extent of actin polymerization by antagonizing filament capping
19213734 the Toca-1-N-WASP complex can link filopodial formation to endocytosis
18708039 Compared with controls, neuronal Wiskott-Aldrich syndrome protein expression in brains of intractable epilepsy patients was significantly higher.
18667055 Wiskostatin induced defective cytokinesis does not occur through the inhibition of the N-WASP pathway.
18430734 of N-WASP and, subsequently, the Arp2/3 complex appears to be an important molecular signal for regulating spines and synapses
18191793 These data constitute evidence that Toca-1 is required for N-WASP-mediated actin polymerization by Shigella flexneri in vivo.
17985201 N-WASP, a member of the N-WASP family may act as a tumour progression suppressor in human breast cancer and may therefore have significant clinical value in this condition.
17573773 CR16 and N-WASP are suggested to play important roles in spermatogenesis
17085436 signal-induced relief of the autoinhibited fold of IQGAP1 allows activation of N-WASP to stimulate Arp2/3-dependent actin assembly
16885158 a vesicle trafficking regulator Toca-1 regulates different aspects of neuronal morphology from N-WASP
16767080 We demonstrate that the interaction of N-WASP with the PSF-NonO complex can couple N-WASP with RNA polymerase II to regulate transcription.
16687395 Nef interferes with maturation of stimulatory T-lymphocyte contacts by modulation of N-Wasp activity
16687395 HIV-1 Nef inhibits the concomitant activation of the actin organizer N-Wasp by interfering with the translocation of N-Wasp to the cell periphery and blocks morphological changes induced by the known N-Wasp regulators Rac1 and Cdc42
16293614 WASP and N-WASP are activated and phosphorylated by protein-tyrosine kinase and GTPase signals
15699051 NF2 tumor suppressor Merlin and the ERM proteins interact with N-WASP and regulate its actin polymerization function
15260990 The cooperative actions of two distinct Cdc42 effectors, the N-WASP-WIP complex and Toca-1, are required for Cdc42-induced actin assembly.
15169891 Erk phosphorylation liberates the SH3 domain of cortactin from intramolecular interactions with proline-rich regions, causing it to synergize with WASP and N-WASP in activating the Arp2/3 complex
15102814 Expression of the WA fragment of N-WASP to block associated actin polymerization also inhibited C. parvum invasion.
12871950 nuclear localization of N-WASP modulates Src kinase activity by regulating HSP90 expression

AA Sequence

MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKD      1 - 70
NPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGR     71 - 140
RQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQ    141 - 210
HIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPP    211 - 280
PPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPAL    281 - 350
PSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLK    351 - 420
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDED    421 - 490
EDDEEDFEDDDEWED                                                           491 - 505
//

Text Mined References (120)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26986510 2016 Cdc42 deficiency induces podocyte apoptosis by inhibiting the Nwasp/stress fibers/YAP pathway.
26554011 2015 Allosteric N-WASP activation by an inter-SH3 domain linker in Nck.
26506240 2015 Growth-arrest-specific 7C protein inhibits tumor metastasis via the N-WASP/FAK/F-actin and hnRNP U/?-TrCP/?-catenin pathways in lung cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463123 2015 Molecular difference between WASP and N-WASP critical for chemotaxis of T-cells towards SDF-1?.
26305187 2015 RTVP-1 regulates glioma cell migration and invasion via interaction with N-WASP and hnRNPK.
26070569 2015 Role of N-WASP in Endothelial Monolayer Formation and Integrity.
25482634 2014 Nck adaptors, besides promoting N-WASP mediated actin-nucleation activity at pedestals, influence the cellular levels of enteropathogenic Escherichia coli Tir effector.
25416956 2014 A proteome-scale map of the human interactome network.
25262827 2014 N-WASP is required for Amphiphysin-2/BIN1-dependent nuclear positioning and triad organization in skeletal muscle and is involved in the pathophysiology of centronuclear myopathy.
24385601 2014 Polycystin-1 regulates actin cytoskeleton organization and directional cell migration through a novel PC1-Pacsin 2-N-Wasp complex.
24284073 2014 Cdc42 and the Rho GEF intersectin-1 collaborate with Nck to promote N-WASP-dependent actin polymerisation.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24069415 2013 c-Src and neural Wiskott-Aldrich syndrome protein (N-WASP) promote low oxygen-induced accelerated brain invasion by gliomas.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23760605 2013 Actin-binding protein regulation by microRNAs as a novel microbial strategy to modulate phagocytosis by host cells: the case of N-Wasp and miR-142-3p.
23690407 2013 Human endothelial cells internalize Candida parapsilosis via N-WASP-mediated endocytosis.
23549080 2013 Mycolactone activation of Wiskott-Aldrich syndrome proteins underpins Buruli ulcer formation.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23273897 2013 Loss of Scar/WAVE complex promotes N-WASP- and FAK-dependent invasion.
23212915 2013 Neural Wiskott-Aldrich syndrome protein (N-WASP)-mediated p120-catenin interaction with Arp2-Actin complex stabilizes endothelial adherens junctions.
22921828 2012 Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
22847007 2012 Interactions of isolated C-terminal fragments of neural Wiskott-Aldrich syndrome protein (N-WASP) with actin and Arp2/3 complex.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22585739 2012 Wiskott-Aldrich syndrome protein (WASp) and N-WASp are involved in the regulation of NK-cell migration upon NKG2D activation.
22559840 2012 Claudin-5 is involved in breast cancer cell motility through the N-WASP and ROCK signalling pathways.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21785420 2011 N-WASP regulates the epithelial junctional actin cytoskeleton through a non-canonical post-nucleation pathway.
21769917 2011 WAVE2, N-WASP, and Mena facilitate cell invasion via phosphatidylinositol 3-kinase-dependent local accumulation of actin filaments.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21677511 Tuba and N-WASP function cooperatively to position the central lumen during epithelial cyst morphogenesis.
21610097 2011 Interplay between N-WASP and CK2 optimizes clathrin-mediated endocytosis of EGFR.
21533546 2011 Neural Wiskott-Aldrich syndrome protein is required for accurate chromosome congression and segregation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20936779 2010 A human MAP kinase interactome.
20880986 2010 Estrogen receptor-alpha promotes breast cancer cell motility and invasion via focal adhesion kinase and N-WASP.
20730103 2010 Cdc42 interaction with N-WASP and Toca-1 regulates membrane tubulation, vesicle formation and vesicle motility: implications for endocytosis.
20678498 2010 The mammalian verprolin, WIRE induces filopodia independent of N-WASP through IRSp53.
20146487 2010 Regulation of actin polymerization and adhesion-dependent cell edge protrusion by the Abl-related gene (Arg) tyrosine kinase and N-WASp.
20095995 2010 The expression of CFL1 and N-WASP in esophageal squamous cell carcinoma and its correlation with clinicopathological features.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19487689 2009 Sorting nexin 33 induces mammalian cell micronucleated phenotype and actin polymerization by interacting with Wiskott-Aldrich syndrome protein.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19366662 2009 Insulin receptor tyrosine kinase substrate links the E. coli O157:H7 actin assembly effectors Tir and EspF(U) during pedestal formation.
19262673 2009 The rate of N-WASP exchange limits the extent of ARP2/3-complex-dependent actin-based motility.
19213734 2009 The Toca-1-N-WASP complex links filopodial formation to endocytosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18708039 2008 Overexpression of N-WASP in the brain of human epilepsy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18667055 2008 Inhibition of cytokinesis by wiskostatin does not rely on N-WASP/Arp2/3 complex pathway.
18662323 2008 Characterization of a multidomain adaptor protein, p140Cap, as part of a pre-synaptic complex.
18539136 2008 Alternative splicing affecting the SH3A domain controls the binding properties of intersectin 1 in neurons.
18430734 2008 N-wasp and the arp2/3 complex are critical regulators of actin in the development of dendritic spines and synapses.
18388313 2008 SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.
18191793 2008 Bacterial actin assembly requires toca-1 to relieve N-wasp autoinhibition.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17985201 2008 N-WASP is a putative tumour suppressor in breast cancer cells, in vitro and in vivo, and is associated with clinical outcome in patients with breast cancer.
17573773 2007 Male-specific sterility caused by the loss of CR16.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17085436 2007 IQGAP1 stimulates actin assembly through the N-WASP-Arp2/3 pathway.
16885158 2006 Regulation of neuronal morphology by Toca-1, an F-BAR/EFC protein that induces plasma membrane invagination.
16767080 2006 Regulation of RNA-polymerase-II-dependent transcription by N-WASP and its nuclear-binding partners.
16687395 2006 The HIV-1 pathogenicity factor Nef interferes with maturation of stimulatory T-lymphocyte contacts by modulation of N-Wasp activity.
16582881 2006 Wiskott-Aldrich syndrome protein is involved in alphaIIb beta3-mediated cell adhesion.
16531231 2006 The structural basis of actin interaction with multiple WH2/beta-thymosin motif-containing proteins.
16483316 2006 Protein kinase A-dependent increase in WAVE2 expression induced by the focal adhesion protein vinexin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293614 2006 Protein-tyrosine kinase and GTPase signals cooperate to phosphorylate and activate Wiskott-Aldrich syndrome protein (WASP)/neuronal WASP.
16257963 2005 Phosphorylation of WASP by the Cdc42-associated kinase ACK1: dual hydroxyamino acid specificity in a tyrosine kinase.
16253999 2006 Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation.
16246732 2005 An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins.
16234328 2005 NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS.
15894313 2005 Subconfluent endothelial cells form podosomes downstream of cytokine and RhoGTPase signaling.
15834156 2005 The adapter protein CrkII regulates neuronal Wiskott-Aldrich syndrome protein, actin polymerization, and tension development during contractile stimulation of smooth muscle.
15699051 2005 The NF2 tumor suppressor Merlin and the ERM proteins interact with N-WASP and regulate its actin polymerization function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15260990 2004 Toca-1 mediates Cdc42-dependent actin nucleation by activating the N-WASP-WIP complex.
15169891 2004 Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP.
15102814 2004 Cdc42 and the actin-related protein/neural Wiskott-Aldrich syndrome protein network mediate cellular invasion by Cryptosporidium parvum.
14732713 2004 Identification of splicing variants of Rapostlin, a novel RND2 effector that interacts with neural Wiskott-Aldrich syndrome protein and induces neurite branching.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12872157 2003 A conserved amphipathic helix in WASP/Scar proteins is essential for activation of Arp2/3 complex.
12871950 2003 Translocation of N-WASP by nuclear localization and export signals into the nucleus modulates expression of HSP90.
12853948 2003 The DNA sequence of human chromosome 7.
12732638 2003 Sequential interaction of actin-related proteins 2 and 3 (Arp2/3) complex with neural Wiscott-Aldrich syndrome protein (N-WASP) and cortactin during branched actin filament network formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456725 2003 Small GTPase Tc10 and its homologue RhoT induce N-WASP-mediated long process formation and neurite outgrowth.
12437929 2002 Structure of the N-WASP EVH1 domain-WIP complex: insight into the molecular basis of Wiskott-Aldrich Syndrome.
12372256 2002 The WH1 and EVH1 domains of WASP and Ena/VASP family members bind distinct sequence motifs.
11943145 2002 The acidic regions of WASp and N-WASP can synergize with CDC42Hs and Rac1 to induce filopodia and lamellipodia.
11830518 2002 Essential role of neural Wiskott-Aldrich syndrome protein in podosome formation and degradation of extracellular matrix in src-transformed fibroblasts.
11698281 2001 WASP and N-WASP in human platelets differ in sensitivity to protease calpain.
11584276 2001 Endocytic protein intersectin-l regulates actin assembly via Cdc42 and N-WASP.
11340081 2001 Nck and phosphatidylinositol 4,5-bisphosphate synergistically activate actin polymerization through the N-WASP-Arp2/3 pathway.
11331876 2001 WIP regulates N-WASP-mediated actin polymerization and filopodium formation.
11231575 2001 Activation of Arp2/3 complex-mediated actin polymerization by cortactin.
11179684 2001 PACSIN 3 is a novel SH3 domain cytoplasmic adapter protein of the pacsin-syndapin-FAP52 gene family.
11157975 2001 A novel neural Wiskott-Aldrich syndrome protein (N-WASP) binding protein, WISH, induces Arp2/3 complex activation independent of Cdc42.
11146629 2001 Interaction of WASP/Scar proteins with actin and vertebrate Arp2/3 complex.
11082044 2000 All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.
11052943 2000 Integration of multiple signals through cooperative regulation of the N-WASP-Arp2/3 complex.
10867004 2000 Profilin is required for sustaining efficient intra- and intercellular spreading of Shigella flexneri.
10781580 2000 GRB2 links signaling to actin assembly by enhancing interaction of neural Wiskott-Aldrich syndrome protein (N-WASp) with actin-related protein (ARP2/3) complex.
10724160 2000 Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.
10704453 2000 Syndapin isoforms participate in receptor-mediated endocytosis and actin organization.
10563804 1999 Influence of the C terminus of Wiskott-Aldrich syndrome protein (WASp) and the Arp2/3 complex on actin polymerization.
10491394 1999 Activation of the CDC42 effector N-WASP by the Shigella flexneri IcsA protein promotes actin nucleation by Arp2/3 complex and bacterial actin-based motility.
10467124 1999 Signalling to actin: the Cdc42-N-WASP-Arp2/3 connection.
10381382 1999 Identification of two human WAVE/SCAR homologues as general actin regulatory molecules which associate with the Arp2/3 complex.
10087612 1999 Waltzing with WASP.
9950691 1999 Syndapin I, a synaptic dynamin-binding protein that associates with the neural Wiskott-Aldrich syndrome protein.
9822597 1998 The essential role of profilin in the assembly of actin for microspike formation.
9582270 1998 Neural Wiskott-Aldrich syndrome protein is implicated in the actin-based motility of Shigella flexneri.
9422512 1998 Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP.
9322739 1997 Identification of N-WASP homologs in human and rat brain.