Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.48
PubTator Score 3.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.400 9.0e-03
psoriasis 1.500 1.9e-07
glioblastoma 2.300 5.3e-07
atypical teratoid / rhabdoid tumor 1.700 3.9e-06
medulloblastoma, large-cell 1.600 4.7e-06
primitive neuroectodermal tumor 1.400 4.3e-04
juvenile dermatomyositis 1.334 8.5e-10
acute quadriplegic myopathy 1.095 2.7e-05
adrenocortical carcinoma 1.169 8.6e-04
pediatric high grade glioma 1.700 3.7e-06
pilocytic astrocytoma 1.300 1.8e-04
acute myeloid leukemia 2.100 4.6e-02
subependymal giant cell astrocytoma 2.254 3.9e-02
progressive supranuclear palsy -1.100 1.6e-02
ulcerative colitis 1.200 6.2e-06
ovarian cancer 2.800 1.4e-08

Gene RIF (3)

PMID Text
22673115 Ten KIAA1033 SNPs were also significantly associated with AD in a group of African Americans.
21498477 SWIP is a novel gene for non-syndromic autosomal recessive intellectual disability
20376207 WAFL may play an important role in endocytosis and subsequent membrane trafficking by interacting with AP2 through KIAA0196 and KIAA1033

AA Sequence

MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLP      1 - 70
YEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRF     71 - 140
ISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIETTGVHFQTMYEHLGELLTVLLTLDEIIDNH    141 - 210
ITLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSK    211 - 280
NSTFAEEFAHSIRSIFANVEAKLGEPSEIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAI    281 - 350
TLTANIIWFPDNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQKAQSLTKDVQSYYVFVSSWMMKMESIL    351 - 420
SKEQRMDKFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHMF    421 - 490
YRRSMVVADSVSHITQHLQHQALHSISVAKKRVISDKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVS    491 - 560
LALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQCDCCFLYWHRAVFPIYLDDVYENAVDAARL    561 - 630
HYMFSALRDCVPAMMHARHLESYEILLDCYDKEIMEILNEHLLDKLCKEIEKDLRLSVHTHLKLDDRNPF    631 - 700
KVGMKDLALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAH    701 - 770
LPSQTLEQGLDVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVN    771 - 840
FTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGVTPEGQSYLD    841 - 910
QFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDIVNFEELVKEEGLAEETLKAARHLDSVLSDH    911 - 980
TRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKIGAAFTDDGF    981 - 1050
AMGVAYILKLLDQYREFDSLHWFQSVREKYLKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQEF   1051 - 1120
ELLYFSLSSARIFFRADKTAAEENQEKKEKEEETKTSNGDLSDSTVSADPVVK                    1121 - 1173
//

Text Mined References (16)

PMID Year Title
23676666 2013 The WASH complex, an endosomal Arp2/3 activator, interacts with the Hermansky-Pudlak syndrome complex BLOC-1 and its cargo phosphatidylinositol-4-kinase type II?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22673115 2012 Identification of Alzheimer disease-associated variants in genes that regulate retromer function.
21498477 2011 Identification of a novel candidate gene for non-syndromic autosomal recessive intellectual disability: the WASH complex member SWIP.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20923837 2010 The cargo-selective retromer complex is a recruiting hub for protein complexes that regulate endosomal tubule dynamics.
20498093 2010 WASH and WAVE actin regulators of the Wiskott-Aldrich syndrome protein (WASP) family are controlled by analogous structurally related complexes.
20376207 2010 The ulcerative colitis marker protein WAFL interacts with accessory proteins in endocytosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19922875 2009 The Arp2/3 activator WASH controls the fission of endosomes through a large multiprotein complex.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.