Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.67
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 6.7e-03
hereditary spastic paraplegia -1.082 7.3e-03
intraductal papillary-mucinous neoplasm ... 1.200 7.1e-04
medulloblastoma, large-cell -1.200 7.9e-04
ovarian cancer -2.400 8.4e-10
subependymal giant cell astrocytoma 1.621 3.5e-02

Pathway (1)

Gene RIF (1)

AA Sequence

MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILD      1 - 70
AKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYL     71 - 140
KMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD                    141 - 194
//

Text Mined References (21)

PMID Year Title