Property Summary

NCBI Gene PubMed Count 44
PubMed Score 313.73
PubTator Score 146.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.800 4.1e-06
Astrocytoma, Pilocytic -1.300 4.0e-06
Atopic dermatitis -1.100 2.8e-04
atypical teratoid / rhabdoid tumor -2.700 1.8e-05
Breast cancer -2.200 5.8e-07
breast carcinoma -1.400 5.3e-28
cystic fibrosis 1.257 4.0e-05
ductal carcinoma in situ -1.600 8.0e-03
ependymoma -1.200 7.4e-07
gastric cancer 1.100 4.0e-03
glioblastoma -1.700 3.6e-06
interstitial cystitis -1.100 1.1e-02
intraductal papillary-mucinous adenoma (... -1.400 1.9e-02
intraductal papillary-mucinous carcinoma... -1.800 4.0e-03
invasive ductal carcinoma -2.500 2.6e-04
lung adenocarcinoma -1.100 7.4e-14
non-small cell lung cancer -1.584 2.3e-13
ovarian cancer -3.200 4.6e-12
pancreatic cancer 2.100 2.2e-04
pancreatic carcinoma 2.100 2.2e-04
pancreatic ductal adenocarcinoma liver m... -1.177 1.5e-03
pituitary cancer 1.100 1.9e-04
primitive neuroectodermal tumor -1.400 2.9e-05
subependymal giant cell astrocytoma -1.976 1.2e-03

Gene RIF (32)

AA Sequence

MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQ      1 - 70
DRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPY     71 - 140
RDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQKEQKRIDGTTREVKKVRKARNRRQEWNMMAY    141 - 210
DKELRPDNRLSQSVYHGASSEGSLSPDTRSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQ    211 - 280
AAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPP    281 - 350
VIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH    351 - 420
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSRRIAVEYSDSD    421 - 490
DDSEFDENDWSD                                                              491 - 502
//

Text Mined References (45)

PMID Year Title