Property Summary

NCBI Gene PubMed Count 78
PubMed Score 683.71
PubTator Score 439.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -1.200 1.8e-02
glioblastoma 1.300 1.9e-04
astrocytoma 2.200 3.5e-04
atypical teratoid / rhabdoid tumor 1.200 1.2e-04
pilocytic astrocytoma 1.100 2.4e-07
invasive ductal carcinoma -1.500 4.0e-03

Gene RIF (46)

PMID Text
26490115 the MCP1-induced cortactin phosphorylation is dependent on PLCb3-mediated PKC activation, and siRNA-mediated down-regulation of either of these molecules prevents cortactin interaction with WAVE2
26018170 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
26018170 HIV-1 VLP production/release from Jurkat T lymphocytes requires an intact RAC1-WASF2-BAIAP2-ARP3 pathway as demonstrated by siRNA knockdown experiments
25745180 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
25527710 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
25342748 WASp and WAVE2 differ in their dynamics and their associated proteins
24778020 WAVE2 is down-regulated in gastric cancer
24469447 Cortactin has a role as a scaffold for Arp2/3 and WAVE2 at the epithelial zonula adherens
24415754 these results suggest that Arp2/3 and the upstream regulator, WAVE2, are essential co-factors hijacked by HIV for intracellular migration, and may serve as novel targets to prevent HIV transmission.
24415754 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
24125947 Decreased expression of Wiskott-Aldrich syndrome protein family verprolin-homologous protein 2 may be involved in the development of pre-eclampsia.
23691243 data reveal a critical role for WAVE2 complex in regulation of cellular signaling and epithelial morphogenesis
23435376 Identification of an onco-suppressive role of miR-146a in gastric cancer cells by its reduction of WASF2 expression.
23161539 results suggest that SKAP2 negatively regulates cell migration and tumor invasion in fibroblasts and glioblastoma cells by suppressing actin assembly induced by the WAVE2-cortactin complex
23051739 We demonstrate that WAVE2-Arp2/3 is a major nucleator of actin assembly at the zonula adherens and likely acts in response to junctional Rac signaling
21769917 results indicate that by mediating intensive F-actin accumulation at the sites of cell infiltration, WAVE2, N-WASP, and Mena are crucial for PI3K-dependent cell invasion induced by PDGF
21419341 Data suggest that ERK coordinates adhesion disassembly with WAVE2 regulatory complex activation and actin polymerization to promote productive leading edge advancement during cell migration.
21383498 WAVE2 and WASp define parallel pathways to F-actin reorganization and function in NK cells; although WAVE2 was not required for NK cell innate function, it was accessible through adaptive immunity via IL-2.
21184743 MYH9 is required for lamellipodia formation since it provides contractile forces and tension for the F-actin network to form convex arcs at the leading edge through constitutive binding to WAVE2 and colocalization with PIP(3) in response to IGF-I.
21119216 WAVE2 works as an A-kinase-anchoring protein that recruits PKA at membrane protrusions and plays a role in the enlargement of membrane protrusions induced by PKA activation
20621182 WAVE2 complexs with insulin receptor substrate p53 and is crucial for membrane targeting followed by local accumulation of WAVE2 at the leading edge of cells.
20585556 HIV-1 Gag intracellular localization is modulated by WASF2 and BAIAP2 as demonstrated by double siRNA knockdowns of these cellular proteins (in Jurkat T cells)
19925864 WAVE2-membrane targeting is directionally controlled by binding of the EB1-stathmin complex to WAVE2-bearing microtubules and by the interaction between WAVE2 and PIP3 produced near IGF-IR that is locally activated by IGF-I.
19917258 Data show that activation of the WAVE2 complex requires simultaneous interactions with prenylated Rac-GTP and acidic phospholipids, as well as a specific state of phosphorylation.
19576655 HSPC300 is associated with metastatic potential of lung squamous cell carcinoma through its interaction with WAVE2
19303398 betaPIX and GIT1 regulate the hepatocyte growth factor-induced and Rac1-dependent membrane transport of WAVE2 and consequently, lamellipodia formation.
19162178 Pak1 protein binds to WASF2 protein and is transported with WASF2 protein to the leading edge by stimulation with hepatocyte growth factor.
19012317 Phosphorylation of all five sites on endogenous WAVE2 and their mutation to non-phosphorylatable alanine residues leads to inhibition of WAVE2 function in vivo, was demonstrated.
18809728 Results identify a mechanism by which the WAVE2 complex regulates T cell receptor signaling to Rap1 and integrin activation via Abl- and CrkL-C3G.
18795939 results suggest that long protrusions formed in a WAVE2- and microtubule-dependent manner may identify the cells at the later stage of invasion, possibly after the formation of invadopodia in the 3-D cultures
18514191 Data suggest that the promotion of lamellipodia formation by HGF in MDA-MB-231 cells is Rac1-dependent and requires KIF5B-mediated transport of WAVE2 and IQGAP1 to the cell periphery along microtubules.
18509249 Over-expression of WAVE2 is seen in node-positive cases as well as in moderately and poorly differentiated breast cancers.
17591693 Results decribe a mechanism in which signals from the T cell receptor produce WAVE2-ARP2/3-mediated de novo actin polymerization, leading to integrin clustering and high-affinity binding through the recruitment of vinculin and talin.
17501982 Data show that Chlamydia trachomatis activates Rac and promotes its interaction with WAVE2 and Abi-1 to activate the Arp2/3 complex resulting in the induction of actin cytoskeletal rearrangements that are required for invasion.
17459058 Colocalization of Arp2 and WAVE2 is an independent risk factor for liver metastasis of colorectal carcinoma.
17020969 WAVE2 expression is elevated in HCC tissues, which correlates with a poor prognosis, suggesting WAVE2 as a candidate prognostic marker of HCC.
16899465 c-Abl activates WAVE2 via tyrosine phosphorylation to promote actin remodeling in vivo; Abi-1 forms the crucial link between these two factors
16702231 Therefore, IRSp53 optimizes the activity of the WAVE2 complex in the presence of activated Rac and PIP(3).
16638851 Coexpression of Arp2 and WAVE2 is correlated with poorer patient outcome.
16401421 WAVE2 is a key component of the actin regulatory machinery in T cells and that it also participates in linking intracellular calcium store depletion to calcium release-activated calcium (CRAC) channel activation.
15670045 WAVE-2 and WAVE-3 expression was not changed by the megakaryocytic differentiation; WAVE-1 and WAVE-2 moved from a detergent-soluble cytosolic fraction to insoluble cytoskeleton fraction after platelet aggregation
15657136 Abi-1-mediated coupling of Abl to WAVE2 promotes Abl-evoked WAVE2 tyrosine phosphorylation required to link WAVE2 with activated Rac and with actin polymerization and remodeling at the cell periphery.
15280206 the 3 WAVE isoforms exhibit common and distinct features and may potentially be involved in the regulation of actin cytoskeleton in platelets
15107862 Results suggest that phosphatidylinositol (3,4,5)-triphosphate recruits WAVE2 to the polarized membrane and that this recruitment is essential for lamellipodium formation at the leading edge.
15070726 reconstitution of the Wave-2 complex and a study of the molecular architecture
15048123 The WAVE2-Abi1-Nap1-PIR121 complex is as active as the WAVE2-Abi1 sub-complex in stimulating Arp2/3, and after Rac activation it is re-localized to the leading edge of ruffles in vivo.

AA Sequence

MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAE      1 - 70
RVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYR     71 - 140
DDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQ    141 - 210
EFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDN    211 - 280
QRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPP    281 - 350
SPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL    351 - 420
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSE    421 - 490
FDEDDWSD                                                                  491 - 498
//

Text Mined References (84)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26490115 2015 PLC?3 mediates cortactin interaction with WAVE2 in MCP1-induced actin polymerization and cell migration.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25342748 2014 WASp family verprolin-homologous protein-2 (WAVE2) and Wiskott-Aldrich syndrome protein (WASp) engage in distinct downstream signaling interactions at the T cell antigen receptor site.
25121749 2014 HCMV pUL135 remodels the actin cytoskeleton to impair immune recognition of infected cells.
24778020 2014 Down-regulation of WAVE2, WASP family verprolin-homologous protein 2, in gastric cancer indicates lymph node metastasis and cell migration.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24469447 2014 Cortactin scaffolds Arp2/3 and WAVE2 at the epithelial zonula adherens.
24415754 2014 HIV-1 triggers WAVE2 phosphorylation in primary CD4 T cells and macrophages, mediating Arp2/3-dependent nuclear migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24125947 2014 Decreased expression of Wiskott-Aldrich syndrome protein family verprolin-homologous protein 2 may be involved in the development of pre-eclampsia.
23691243 2013 WAVE2 regulates epithelial morphology and cadherin isoform switching through regulation of Twist and Abl.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23518928 2013 TSPYL5 SNPs: association with plasma estradiol concentrations and aromatase expression.
23435376 2013 MicroRNA-146a acts as a metastasis suppressor in gastric cancer by targeting WASF2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161539 2013 The Src substrate SKAP2 regulates actin assembly by interacting with WAVE2 and cortactin proteins.
23051739 2012 A WAVE2-Arp2/3 actin nucleator apparatus supports junctional tension at the epithelial zonula adherens.
21769917 2011 WAVE2, N-WASP, and Mena facilitate cell invasion via phosphatidylinositol 3-kinase-dependent local accumulation of actin filaments.
21419341 2011 ERK-MAPK drives lamellipodia protrusion by activating the WAVE2 regulatory complex.
21383498 2011 IL-2 induces a WAVE2-dependent pathway for actin reorganization that enables WASp-independent human NK cell function.
21269460 2011 Initial characterization of the human central proteome.
21184743 2011 Nonmuscle myosin IIA is required for lamellipodia formation through binding to WAVE2 and phosphatidylinositol 3,4,5-triphosphate.
21119216 2011 WAVE2 forms a complex with PKA and is involved in PKA enhancement of membrane protrusions.
21107423 2010 Structure and control of the actin regulatory WAVE complex.
20621182 2010 WAVE2 targeting to phosphatidylinositol 3,4,5-triphosphate mediated by insulin receptor substrate p53 through a complex with WAVE2.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19925864 2010 Directional control of WAVE2 membrane targeting by EB1 and phosphatidylinositol 3,4,5-triphosphate.
19917258 2009 Activation of the WAVE complex by coincident signals controls actin assembly.
19798448 2009 Requirements for F-BAR proteins TOCA-1 and TOCA-2 in actin dynamics and membrane trafficking during Caenorhabditis elegans oocyte growth and embryonic epidermal morphogenesis.
19576655 2009 Metastatic potential of lung squamous cell carcinoma associated with HSPC300 through its interaction with WAVE2.
19303398 2009 BetaPIX and GIT1 regulate HGF-induced lamellipodia formation and WAVE2 transport.
19162178 2009 Membrane transport of WAVE2 and lamellipodia formation require Pak1 that mediates phosphorylation and recruitment of stathmin/Op18 to Pak1-WAVE2-kinesin complex.
19012317 2009 WAVE2 is regulated by multiple phosphorylation events within its VCA domain.
18856062 [A new member of the WAS genes family (WASF4)].
18809728 2008 The WAVE2 complex regulates T cell receptor signaling to integrins via Abl- and CrkL-C3G-mediated activation of Rap1.
18795939 2008 WAVE2- and microtubule-dependent formation of long protrusions and invasion of cancer cells cultured on three-dimensional extracellular matrices.
18560548 2008 Free Brick1 is a trimeric precursor in the assembly of a functional wave complex.
18514191 2008 Requirement of kinesin-mediated membrane transport of WAVE2 along microtubules for lamellipodia formation promoted by hepatocyte growth factor.
18509249 2007 Expression of the WASP verprolin-homologues (WAVE members) in human breast cancer.
17591693 2007 WAVE2 regulates high-affinity integrin binding by recruiting vinculin and talin to the immunological synapse.
17501982 2007 Rac interacts with Abi-1 and WAVE2 to promote an Arp2/3-dependent actin recruitment during chlamydial invasion.
17459058 2007 Correlation between liver metastasis of the colocalization of actin-related protein 2 and 3 complex and WAVE2 in colorectal carcinoma.
17101133 2006 NESH (Abi-3) is present in the Abi/WAVE complex but does not promote c-Abl-mediated phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17020969 2006 Increased expression of Wiskott-Aldrich syndrome protein family verprolin-homologous protein 2 correlated with poor prognosis of hepatocellular carcinoma.
16899465 2006 c-Abl interacts with the WAVE2 signaling complex to induce membrane ruffling and cell spreading.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16702231 2006 Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.
16638851 2006 Coexpression of actin-related protein 2 and Wiskott-Aldrich syndrome family verproline-homologous protein 2 in adenocarcinoma of the lung.
16483316 2006 Protein kinase A-dependent increase in WAVE2 expression induced by the focal adhesion protein vinexin.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
16401421 2006 The WAVE2 complex regulates actin cytoskeletal reorganization and CRAC-mediated calcium entry during T cell activation.
16275905 2005 Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly.
15772651 2005 The DNA sequence of the human X chromosome.
15670045 2005 Expression and subcellular localization of WAVE isoforms in the megakaryocyte/platelet lineage.
15657136 2005 Abelson-interactor-1 promotes WAVE2 membrane translocation and Abelson-mediated tyrosine phosphorylation required for WAVE2 activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280206 2005 WAVE/Scars in platelets.
15107862 2004 PtdIns(3,4,5)P3 binding is necessary for WAVE2-induced formation of lamellipodia.
15070726 2004 Purification and architecture of the ubiquitous Wave complex.
15048123 2004 Abi1 is essential for the formation and activation of a WAVE2 signalling complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12181570 2002 Mechanism of regulation of WAVE1-induced actin nucleation by Rac1 and Nck.
12054568 2002 WAVE2 serves a functional partner of IRSp53 by regulating its interaction with Rac.
11773052 2002 Drosophila Ack targets its substrate, the sorting nexin DSH3PX1, to a protein complex involved in axonal guidance.
11246027 2001 The Wiskott-Aldrich syndrome protein (WASP) family.
11146629 2001 Interaction of WASP/Scar proteins with actin and vertebrate Arp2/3 complex.
11130076 2000 IRSp53 is an essential intermediate between Rac and WAVE in the regulation of membrane ruffling.
11073096 2000 Cellular signaling in macrophage migration and chemotaxis.
10970852 2000 Scar/WAVE-1, a Wiskott-Aldrich syndrome protein, assembles an actin-associated multi-kinase scaffold.
10532312 1999 Interaction between Wiskott-Aldrich Syndrome protein (WASP) and the Fyn protein-tyrosine kinase.
10427990 1999 The SH3 domain of Bruton's tyrosine kinase displays altered ligand binding properties when auto-phosphorylated in vitro.
10381382 1999 Identification of two human WAVE/SCAR homologues as general actin regulatory molecules which associate with the Arp2/3 complex.
10202051 1999 Mutations that cause the Wiskott-Aldrich syndrome impair the interaction of Wiskott-Aldrich syndrome protein (WASP) with WASP interacting protein.
9950691 1999 Syndapin I, a synaptic dynamin-binding protein that associates with the neural Wiskott-Aldrich syndrome protein.
9889097 1998 Scar1 and the related Wiskott-Aldrich syndrome protein, WASP, regulate the actin cytoskeleton through the Arp2/3 complex.
9804817 1998 PSTPIP 2, a second tyrosine phosphorylated, cytoskeletal-associated protein that binds a PEST-type protein-tyrosine phosphatase.
9732292 1998 SCAR, a WASP-related protein, isolated as a suppressor of receptor defects in late Dictyostelium development.
9307968 1997 Wiskott-Aldrich syndrome protein is associated with the adapter protein Grb2 and the epidermal growth factor receptor in living cells.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.