Property Summary

NCBI Gene PubMed Count 63
PubMed Score 1003.77
PubTator Score 601.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 2.000 1.4e-02
astrocytic glioma -1.700 3.2e-03
ependymoma -2.500 7.2e-03
glioblastoma -2.600 1.2e-05
oligodendroglioma -1.200 5.2e-13
osteosarcoma -1.026 3.7e-02
atypical teratoid / rhabdoid tumor -1.900 9.2e-06
medulloblastoma -1.300 4.0e-06
primitive neuroectodermal tumor -1.200 4.7e-03
adrenocortical carcinoma 1.127 1.2e-03
tuberculosis 1.100 1.5e-03
non-small cell lung cancer 1.629 2.3e-14
intraductal papillary-mucinous adenoma (... -1.400 4.0e-04
intraductal papillary-mucinous carcinoma... -1.200 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.2e-02
lung cancer 2.000 7.0e-05
pediatric high grade glioma -1.700 7.7e-04
subependymal giant cell astrocytoma -1.913 3.7e-02
invasive ductal carcinoma -1.400 2.8e-03
lung carcinoma 1.300 5.6e-20
ovarian cancer -1.600 1.4e-05

 GO Function (1)

Gene RIF (36)

PMID Text
26977009 Results implicate a contributory role of WAVE1 and -3 to the metastatic phenotype of PC-3 cells through their interaction with the ARP2/3 complex.
26280122 A decrease in amounts of WASF1 mRNA was also observed in human Alzheimer's disease brains, suggesting clinical relevance of the negative feedback circuit involved in homeostatic regulation of Abeta production
25906751 we propose that WASF1 status defines a subtype of androgen deprivation therapy -resistant prostate cancer patients
25799492 a role for ARF6 in linking EGF-receptor signaling to Rac1 recruitment and activation at the plasma membrane to promote breast cancer cell directed migration
25745180 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25527710 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25473116 WAVE1 has unique activities independent of Arp2/3 complex that can govern both the growth rates and architectures of actin filament networks. Elongation inhibitory effects of WAVE1 were mapped to its WH2 ("V") domain.
25355952 The WAVE complex is the main activator of the Arp2/3 complex for actin filament nucleation and assembly in the lamellipodia of moving cells.
24819384 D620N mutation in VPS35 restricts WASH complex recruitment to endosomes, and reveals a novel role for the WASH complex in autophagosome formation.
23680521 WAVE1 might promote the proliferative and invasive malignant behaviors through the activation of the PI3K/AKT and p38MAPK signaling pathways in epithelial ovarian cancer.
23452202 mRNAs encoding structural and regulatory components of the WAVE complex are localized to the leading edge of the cell, suggesting that localized protein synthesis plays a pivotal role in controlling cell spreading and migration.
23273897 Scar/WAVE regulatory complex and N-WASP play opposing roles in 3D epithelial cell migration
22721732 Study finds that WAVE1 overexpression is associated with an unfavorable prognosis. WAVE1 is an independent prognostic factor for EOC, which suggests that it is a novel and crucial predictor for EOC metastasis.
22179776 mDia1 and WAVE2 are important Src homology 3 domain partners of IRSp53 in forming filopodia.
21844371 Arf GTPases may be central components in WAVE signalling, acting directly, alongside Rac1.
20426950 Higher levels of WAVE1 in the bone marrow indicate an unfavorable prognosis in children with AML.
20368433 Dock3 induces axonal outgrowth by stimulating membrane recruitment of the WAVE complex
19890377 WAVE1 regulates Bcl-2 localization and phosphorylation in leukemia cells.
19731823 WAVE1 might be involved in the migration and invasion of K562 cells through regulation of the expression level of MMP-2.
19631450 CIP4 is a new ArgBP2 interacting protein that modulates the ArgBP2 mediated control of WAVE1 phosphorylation and cancer cell migration.
19497998 WAVE accumulation may be involved in Abeta/amyloid precursor protein mediated-tangle modification
19222940 WAVE1 and p22phox expression in PBMCs increased and was associated with the disease course in children with acute lymphocytic leukemia (ALL).
18995840 Dimerization act in hierarchical fashion, enabling WASP/WAVE proteins to integrate different classes of inputs to produce a wide range of cellular actin responses in Wiskoo Aldrich syndrome.
18947485 The WAVE1 expression increased in children with ALL. WAVE1 may be related to the development of ALL and may be severed as a marker for the evaluation of the severity of ALL in children.
18516090 Results suggest that WAVE and the Arp2/3 complex jointly orchestrate different types of actin-based plasma membrane protrusions by promoting ruffling and inhibiting mDia2-induced filopodia.
18287015 WAVE1 dephosphorylation and activation are likely associated with mitochondrial redistribution and dendritic spine morphogenesis.
17939402 WAVE1 is involved in multi-drug resistance through regulation the level of mdrl and Bcl-2.
17901257 WAVE1 is critical for formation of oligodendrocyte lamellae and myelin sheaths--REVIEW
17696648 the Hem-1/Nap1 component of the Scar/WAVE complex localizes to propagating waves that appear to organize the leading edge of a motile neutrophil
17101133 NESH (Abi-3), like Abi-1 and Abi-2, is a component of the Abi/WAVE complex, but likely plays a different role in the regulation of c-Abl.
15670045 WAVE-1 expression was associated with megakaryocytic differentiation; WAVE-1 and WAVE-2 moved from a detergent-soluble cytosolic fraction to insoluble cytoskeleton fraction after platelet aggregation
15506982 Dictyostelium discoideum has been used to remove genetically SCAR complex members to ascertain their specific roles.
15280206 the 3 WAVE isoforms exhibit common and distinct features and may potentially be involved in the regulation of actin cytoskeleton in platelets
12855698 WAVE1 may act as a scaffold to recruit the NADPH oxidase to a complex involved with both cytoskeletal regulation and downstream JNK activation
12429845 Results suggest that recruitment of factors by Wiskott-Aldrich Syndrome protein (WASP) and Scar1 stimulates cellular actin-based motility and actin nucleation with the Arp2/3 complex.
12181570 Mechanism of regulation of WAVE1-induced actin nucleation by Rac1 and Nck: we propose that Rac1 and Nck cause dissociation of the WAVE1 complex, which releases active WAVE1-HSPC300 and leads to actin nucleation.

AA Sequence

MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQ      1 - 70
ERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPY     71 - 140
RDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQG    141 - 210
PELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPP    211 - 280
PPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPP    281 - 350
PVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV    351 - 420
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPST    421 - 490
LPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE     491 - 559
//

Text Mined References (66)

PMID Year Title
26977009 2016 The Association Between WAVE1 and -3 and the ARP2/3 Complex in PC 3 Cells.
26280122 2015 APP intracellular domain-WAVE1 pathway reduces amyloid-? production.
25906751 2015 Loss of Wave1 gene defines a subtype of lethal prostate cancer.
25799492 2015 ARF6 promotes the formation of Rac1 and WAVE-dependent ventral F-actin rosettes in breast cancer cells in response to epidermal growth factor.
25473116 2015 A novel role for WAVE1 in controlling actin network growth rate and architecture.
25416956 2014 A proteome-scale map of the human interactome network.
25355952 2015 WAVE binds Ena/VASP for enhanced Arp2/3 complex-based actin assembly.
24819384 2014 Mutation in VPS35 associated with Parkinson's disease impairs WASH complex association and inhibits autophagy.
24439377 2014 Local F-actin network links synapse formation and axon branching.
23680521 2013 WAVE1 gene silencing via RNA interference reduces ovarian cancer cell invasion, migration and proliferation.
23452202 2013 mRNA encoding WAVE-Arp2/3-associated proteins is co-localized with foci of active protein synthesis at the leading edge of MRC5 fibroblasts during cell migration.
23273897 2013 Loss of Scar/WAVE complex promotes N-WASP- and FAK-dependent invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22721732 2012 High level of WAVE1 expression is associated with tumor aggressiveness and unfavorable prognosis of epithelial ovarian cancer.
22179776 2012 mDia1 and WAVE2 proteins interact directly with IRSp53 in filopodia and are involved in filopodium formation.
21844371 2011 WAVE regulatory complex activation by cooperating GTPases Arf and Rac1.
21107423 2010 Structure and control of the actin regulatory WAVE complex.
20426950 2010 [Interaction of WAVE1 and genes involved in multiple drug resistance in children with acute myeloblastic leukemia].
20368433 2010 Dock3 induces axonal outgrowth by stimulating membrane recruitment of the WAVE complex.
19890377 2010 WAVE1 regulates Bcl-2 localization and phosphorylation in leukemia cells.
19731823 2009 [Role of WAVE1 in K562 leukemia cells invasion and its mechanism].
19631450 2010 CIP4 is a new ArgBP2 interacting protein that modulates the ArgBP2 mediated control of WAVE1 phosphorylation and cancer cell migration.
19497998 2009 Involvement of WAVE accumulation in Abeta/APP pathology-dependent tangle modification in Alzheimer's disease.
19222940 2009 [Expression of WAVE1 and p22phox in children with acute lymphocytic leukemia and the relationship of WAVE1 with oxidative stress].
18995840 2008 Hierarchical regulation of WASP/WAVE proteins.
18947485 2008 [Expression of WAVE1 in childhood acute lymphocytic leukemia and in the apoptosis of Jurkat cells induced by adriamycin].
18559503 2008 ArgBP2-dependent signaling regulates pancreatic cell migration, adhesion, and tumorigenicity.
18516090 2008 WAVE and Arp2/3 jointly inhibit filopodium formation by entering into a complex with mDia2.
18287015 2008 WAVE1 controls neuronal activity-induced mitochondrial distribution in dendritic spines.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17939402 2007 [Role of WAVE1 in drug resistance of K562/A02 leukemia cells].
17901257 2007 WAVE1 and regulation of actin nucleation in myelination.
17696648 2007 An actin-based wave generator organizes cell motility.
17101133 2006 NESH (Abi-3) is present in the Abi/WAVE complex but does not promote c-Abl-mediated phosphorylation.
15670045 2005 Expression and subcellular localization of WAVE isoforms in the megakaryocyte/platelet lineage.
15506982 2004 Control of SCAR activity in Dictyostelium discoideum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280206 2005 WAVE/Scars in platelets.
15048733 2004 CYFIP2 is highly abundant in CD4+ cells from multiple sclerosis patients and is involved in T cell adhesion.
15048123 2004 Abi1 is essential for the formation and activation of a WAVE2 signalling complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14506234 2003 Tuba, a novel protein containing bin/amphiphysin/Rvs and Dbl homology domains, links dynamin to regulation of the actin cytoskeleton.
12931191 2003 BAD and glucokinase reside in a mitochondrial complex that integrates glycolysis and apoptosis.
12872157 2003 A conserved amphipathic helix in WASP/Scar proteins is essential for activation of Arp2/3 complex.
12855698 2003 Vascular endothelial growth factor causes translocation of p47phox to membrane ruffles through WAVE1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447388 2002 The WRP component of the WAVE-1 complex attenuates Rac-mediated signalling.
12429845 2002 Motility determinants in WASP family proteins.
12181570 2002 Mechanism of regulation of WAVE1-induced actin nucleation by Rac1 and Nck.
11146629 2001 Interaction of WASP/Scar proteins with actin and vertebrate Arp2/3 complex.
11130076 2000 IRSp53 is an essential intermediate between Rac and WAVE in the regulation of membrane ruffling.
11052943 2000 Integration of multiple signals through cooperative regulation of the N-WASP-Arp2/3 complex.
10970852 2000 Scar/WAVE-1, a Wiskott-Aldrich syndrome protein, assembles an actin-associated multi-kinase scaffold.
10563804 1999 Influence of the C terminus of Wiskott-Aldrich syndrome protein (WASp) and the Arp2/3 complex on actin polymerization.
10532312 1999 Interaction between Wiskott-Aldrich Syndrome protein (WASP) and the Fyn protein-tyrosine kinase.
10381382 1999 Identification of two human WAVE/SCAR homologues as general actin regulatory molecules which associate with the Arp2/3 complex.
9889097 1998 Scar1 and the related Wiskott-Aldrich syndrome protein, WASP, regulate the actin cytoskeleton through the Arp2/3 complex.
9843499 1998 WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.
9804817 1998 PSTPIP 2, a second tyrosine phosphorylated, cytoskeletal-associated protein that binds a PEST-type protein-tyrosine phosphatase.
9732292 1998 SCAR, a WASP-related protein, isolated as a suppressor of receptor defects in late Dictyostelium development.
9463375 1998 In mouse brain profilin I and profilin II associate with regulators of the endocytic pathway and actin assembly.
9307968 1997 Wiskott-Aldrich syndrome protein is associated with the adapter protein Grb2 and the epidermal growth factor receptor in living cells.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
8605018 1996 Molecular cloning of p125Nap1, a protein that associates with an SH3 domain of Nck.
2775266 1989 Preliminary biochemical characterization of two angiotensin II receptor subtypes.