Property Summary

NCBI Gene PubMed Count 184
PubMed Score 1138.71
PubTator Score 776.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.100 3.5e-06
cutaneous lupus erythematosus 1.700 2.2e-03
psoriasis 2.700 1.7e-05
osteosarcoma -3.511 1.0e-06

Gene RIF (112)

PMID Text
26463123 This suggests that N-WASP's failure to compensate for WASP in rescuing chemotaxis could be due to the absence of this I30 region.
26368308 The introduction of functional WASp by GT corrected the alterations of both central and peripheral B cell tolerance checkpoints. WASp plays an important role in the establishment and maintenance of B cell tolerance in humans.
26277674 We describe two Malay patients with classical Wiskott-Aldrich Syndrome with two different mutations in the WASP gene
26261240 we identify small ubiquitin-related modifier (SUMO)ylation as a novel posttranslational modification of WASp
26175287 WASP, RUNX1, and ANKRD26 genes are important for normal TPO signaling and the network underlying thrombopoiesis.
26159751 Studies indicate that mutations in the Wiskott-Aldrich syndrome protein (WASp) gene cause a continuum of clinical symptoms ranging from intermittent X-linked thrombocytopenia to full classical Wiskott-Aldrich syndrome (WAS).
26028144 Platelet actin nodule formation is dependent on WASp and the ARP2/3 complex.
25931402 A total of 60 unique WAS mutations were identified in Chinese patients, including 20 novel mutations and 8 hotspots, from 75 unrelated families with a total of 81 affected members.
25413351 conclude that tyrosine phosphorylation of WIP is a crucial regulator of WASP stability and function as an actin-nucleation-promoting factor
25388447 retrospectively investigated the outcome of hematopoietic stem cell transplantation in a cohort of 24 patients with the X-linked thrombocytopenia phenotype and mutations in the WAS gene
25342748 WASp and WAVE2 differ in their dynamics and their associated proteins
25277185 studies discovered that HMGB1 suppressed phosphorylation, nuclear translocation, and activation of CREB, by inhibiting nuclear translocation of PKA catalytic subunit
25253772 An indispensable relationship between nuclear-WASp- and hSWI/SNF-complexes in gene activation and molecular distinctions in TH cells that might contribute to disease severity in the X-linked thrombocytopenia/Wiskott-Aldrich syndrome clinical spectrum.
25200405 data suggest that missense mutations WASPRL46P or WASPRA47D affect the activity of WASP in T cell chemotaxis probably by affecting the turnover of the protein.
25158122 Data indicate that mycolactone analogues bind Wiskott-Aldrich syndrome proteins (WASP} with IC50 in the 50-10 muM range.
25154619 WAS gene mutation is associated with X-linked thrombocytopenia in three males with normal sized platelets.
25115631 N-WASP is downregulated in clear cell renal cell carcinoma
24962707 Data indicate the WASp-interacting protein (WIP)-Wiskott-Aldrich syndrome protein (WASp) interaction in the regulation of actin-dependent processes.
24945741 These findings support a contributory role for defective Breg cells in the development of WAS-related autoimmunity
24872192 study unveils an ARP2/3:VCA-independent function of nuclear-WASp in TH1 gene activation that is uncoupled from its cytoplasmic role in actin polymerization.
24440360 Pro373Ser mutation reduces Tyr291 phosphorylation and prevents conformational changes required for WASP activity in chemotaxis and T-cell activation.
24369837 WASP deficiency perturbs the homeostasis of B-cell compartment in humans.
24133214 We conclude that WASp function restricts TGF-b1 secretion in a Cdc42- and Src family kinase-dependent manner and independently of actin assembly
24115682 Missense mutation in the WAS gene is associated with intermittent X-linked thrombocytopenia.
23455509 Dedicator of cytokinesis 8 interacts with talin and Wiskott-Aldrich syndrome protein to regulate NK cell cytotoxicity.
23301916 We present two cases of WAS in neonates with WAS gene mutations
23264413 Report five previously reported mutations and six novel mutations in WASP gene in Iranian Wiskott-Aldrich patients.
23237501 this is the first report describing TTP in WAS patients with novel mutation in the WASP gene.
23160469 Despite mediating enhanced actin polymerization, EVH1 missense-mutated human proteins did not function fully in mouse cells, even when overexpressed. Mutant protein retention in podosomes was impaired & associated with low WASp Tyr phosphorylation.
23119100 Data indicate that slit2N alters the localization and binding of Robo1 to WASp and LSP1 in HIV-1-gp120-treated immature dendritic cells (iDCs).
23119100 M-tropic HIV-1 gp120 enhances the binding of WASp and the actin-related protein 2/3 complex with beta-actin, an interaction essential for the proper formation of podosomes in immature monocyte-derived dendritic cells
22944692 M-tropic HIV-1 gp120 enhances the binding of WASp and the actin-related protein 2/3 complex with beta-actin, an interaction essential for the proper formation of podosomes in immature monocyte-derived dendritic cells
22804504 WASP-deficient T cells migrated in a normal proportion towards CXCL12, CCL19 and CCL21, but displayed an increased adhesion and elongation on ICAM-1
22665495 data suggest that regulated degradation of activated WASp might be an efficient strategy by which the duration and localization of actin rearrangement and the intensity of T-cell activation are controlled.
22585739 study describes that both N-WASp and WASp participate in the inhibition of NK-cell chemotaxis in response to NKG2D WASp engagement, and that this effect is not dependent on the regulation of F-actin dynamics
22311461 The wild-type WASp, but not the mutant restored adhesion capacity, spreading morphology, and cytoskeletal reorganization.
22038941 Mutation in WASP gene is associated with Wiskott-Aldrich syndrome and X-linked thrombocytopenia.
21711396 the c.273+11dup change within the WAS gene was observed in patients showing symptoms consistent with the Wiskott-Aldrich syndrome; concluded that the presence of the additional C in the WAS gene is a functionally neutral polymorphism
21690559 WASp-deficiency compromised the ability of Wiskott-Aldrich DCs to prime T cells to react appropriately, Genetic complementation with transduced human WASp restored functionality.
21676863 activation of the Arp2/3 complex by the conserved VCA domain of WASP most likely involves engagement of two distinct sites on Arp2/3 complex by two VCA molecules, each delivering an actin monomer. One site is on Arp3 and the second is on ARPC1 and Arp2
21562048 M-tropic HIV-1 gp120 enhances the binding of WASp and the actin-related protein 2/3 complex with beta-actin, an interaction essential for the proper formation of podosomes in immature monocyte-derived dendritic cells
21383498 WAVE2 and WASp define parallel pathways to F-actin reorganization and function in NK cells; although WAVE2 was not required for NK cell innate function, it was accessible through adaptive immunity via IL-2.
21185603 mutations were scattered throughout the WASP gene and included single base pair changes (17 missense and 11 nonsense mutations), 7 small insertions, 18 deletions, and 9 splice site defects
21178275 WASP is key in transducing signals from the cell surface to the actin cytoskeleton, and a lack of WASp results in cytoskeletal defects that compromise multiple aspects of normal cellular activity. Review.
20574068 A nuclear role for WASp in the transcriptional regulation of the TH1 regulator gene TBX21 at the chromatin level, was discovered.
20354175 Lymphocytes isolated from a patient with WASP(I294T), and in a cellular model of WASP(I294T), displayed abnormal microvillar architecture, associated with an increase in total cellular F-actin.
20232122 a clustering pattern on exon 1 and five unique mutations explain the genetic variations in different ethnic groups
19859091 Observational study of genetic testing. (HuGE Navigator)
19817875 The results suggest that some of the mutations in the WH1 domain cause the Wiskott-Aldrich syndrome syndrome in humans by perturbing the WASP-WIP complex formation.
19808890 Cdc42 binding and activation of WASp are required for podosome formation and chemotaxis.
19630517 Was cDNA sequences increased the hematopoietic specificity of Was promoter-driven lentiviral vector.
19561083 CSF-1-induced WASP activation was fully Cdc42-dependent.
19487689 SNX33 plays a role in maintaining cell shape and cell cycle progression through its interaction with WASp
19155218 formin-binding protein 17 (FBP17) recruits WASP, WASP-interacting protein (WIP), and dynamin-2 to the plasma membrane and that this recruitment is necessary for the formation of podosomes and phagocytic cups.
19006568 data from this large pedigree with the WAS I294T mutation provide new independent genetic evidence that mutations disrupting the auto-inhibitory GTP-ase binding domain of WASP are the cause of X-linked neutropenia
18995840 Dimerization act in hierarchical fashion, enabling WASP/WAVE proteins to integrate different classes of inputs to produce a wide range of cellular actin responses in Wiskoo Aldrich syndrome.
18948384 Robo4 binding to a Wiskott-Aldrich syndrome protein (WASP)
18941616 the presence of truncated WASP confers an extreme disadvantage in early developing thymocytes, beyond that of absence of full-length WASP, and the disadvantage likely occurs through dominant negative competition of WASP Delta VCA with N-WASP
18654788 One gene with unknown function to be differentially expressed in UC but not Crohn's disease by RT-PCR. Due to its predicted protein architecture, we call this gene Wiskott-Aldrich syndrome protein.
18332229 Genotypic analysis of allospecific T-cell clones revealed a remarkable diversity of deletions and base substitutions resulting in at least 34 different revertant genotypes that restored expression of WASp
18043243 The discovery of unique functional domains of Wiskott-Aldrich syndrome protein has been instrumental in defining mechanisms that control activation of Wiskott-Aldrich syndrome protein. Review.
17890224 that WASP and WASP-interacting protein (WIP) form a complex at the phagocytic cup and that the WASP.WIP complex plays a critical role in the phagocytic cup formation.
17724125 These findings reveal a novel mechanism for inhibition of myelopoiesis through defective mitosis and cytokinesis due to hyperactivation and mislocalization of actin polymerization.
17719003 Study provides a strategy that allows a strong suppression of WASp in CD34(+) cells and will facilitate future studies on the role of WASp in human cells.
17711847 the WIP-WASP complex plays an important role in WASP stabilization and NFAT activation
17703096 Chinese Wiskott-Aldrich Syndrome (WAS) patients had mutations involving exon 1 of the Wiskott-Aldrich syndrome protein (WASP) gene and none had the X-linked thrombocytopenia phenotype.
17400488 study found 28 novel WAS mutations in Wiskott-Aldrich syndrome and X-linked thrombocytopenia (7 missense, 1 nonsense, 1 nonstop change, 5 splice site mutations and 14 deletions or insertions)
17390083 Two novel mutations of the WASP gene in two Spanish families with patients clinically diagnosed as havingX-linked thrombocytopenia and Wiskott-Aldrich syndrome, were identified.
17296785 Thus, WASP appears to play an important role in the activation and suppressor function of nTreg cells, and a dysfunction or incorrect localization of nTreg cells may contribute to the development of autoimmunity in WAS patients.
17242350 the WASp/SNX9/p85/CD28 complex enables a unique interface of endocytic, actin polymerizing, and signal transduction pathways required for CD28-mediated T cell costimulation
17065640 investigated family members of the patients originally described by Wiskott in 1937 and identified a new frame shift mutation in exon 1 of WAS
16901726 impaired beta2 integrin function in WASp-deficient neutrophil may contribute substantially to the clinical immunodeficiency suffered by WAS patients
16804117 activating mutations in the Wiskott-Aldrich syndrome protein result in congenital neutropenia
16709815 In addition to chemotaxis, the WASP-verprolin complex is involved in both podosome formation and phagocytosis.
16582881 WASP binds to the calcium- and integrin-binding protein (CIB) in platelets.
16511828 The results strongly suggest that the smaller WASP is translated from the second ATG downstream of the original mutation, and not only T cells but also NK cells carrying the second mutation acquired a growth advantage over WASP negative counterparts.
16488394 Human WASP suppresses the growth defect of Saccharomyces cerevisiae las17Delta strain, only in the presence of WASP-interacting protein (WIP).
16372137 A novel Wiskott-Aldrich syndrome protein (WASP) complex mutation identified in a WAS patient results in an aberrant product at the C-terminus from two transcripts with unusual polyA signals.
16360341 A partial down-regulation of WASP is sufficient to inhibit podosome formation in dendritic cells.
16293614 WASP and N-WASP are activated and phosphorylated by protein-tyrosine kinase and GTPase signals
16285728 NMR investigation and cross-linking studies of the interaction of the Arp2/3 complex with VCA peptides of Wiskott-Aldrich syndrome protein
16278221 TRAP and WASp, but not other unrelated aldolase binders, compete for the binding to the enzyme in vitro.
16246732 The process is a prerequisite for WASp activation and a critical step in temporal regulation and integration of WASp-mediated cellular responses.
16002738 Knowledge of the molecular effect of WAS protein mutations provides a logical basis for correlating genotype and clinical phenotype of Wiskott-Aldrich syndrome
15985539 The selective advantage of WASP+ natural killer cells was also demonstrated for carrier females
15821030 Results describe a quantitative model of allosteric regulation of the Wiskott-Aldrich syndrome protein (WASP) by the Rho GTPase Cdc42.
15728466 The Wiskott-Aldrich WASP protein is an important component for integration of signals leading to nuclear translocation of transcription factors NFAT2 and NF-kappa B RelA during cell-cell contact and natural cytotoxicity receptor NKp46-dependent signaling.
15497008 Mutations identified included p.R13X, p.R41X, p.S82P, IVS1-1 G --> C, p.L342TFsX493, and a large deletion.
15469902 interactions of WASP and WIP are affected by two novel mutations that change the conformation of WASP and disrupt hydrogen bonding
15130947 WASp is either not involved in or is redundant in the rapid dynamics of lymphocyte microvilli.
15001467 WASp undergoes tyrosine phosphorylation upon CD16 or beta2-integrin engagement on NK cells.
14559906 the interaction of the betaPIX.WASP.SPIN90 complex with Nck is crucial for stable cell adhesion and can be dynamically modulated by SPIN90 phosphorylation that is dependent on cell adhesion and ERK activation
14504083 Differentiation and survival of B lymphocytes is minimally dependent on WAS protein.
12969986 WAS protein expression is a useful tool for predicting long-term prognosis for patients with Wiskott-Aldrich syndrome.
12791263 Phosphorylation plays a critical role in WASP function as a regulator of arp-2- and arp-3-mediated actin polymerization.
12727931 Results describe somatic mosaicism in two brothers affected with Wiskott-Aldrich syndrome (WAS) due to a second-site mutation in the WAS protein (WASP) gene.
12591280 X-linked thrombocytopenia caused by a mutation in the WAS gene that disrupts interaction with the (WASP)-interacting protein (WIP).
12530983 PSTPIP1 acts downstream of CD2/CD2AP to link CD2 engagement to the WASp-evoked actin polymerization required for synapse formation and T cell activation.
12504004 results suggest that the ZAP-70-CrkL-WIP pathway and PKCtheta link TCR to WASP activation
12429845 Results suggest that recruitment of factors by Wiskott-Aldrich Syndrome protein (WASP) and Scar1 stimulates cellular actin-based motility and actin nucleation with the Arp2/3 complex.
12351383 mutated in Wiskott Aldrich syndrome
12235133 Data show that the Src family kinase Hck induces phosphorylation of Wiskott Aldrich syndrome protein (WASp)-Tyr(291) independently of Cdc42 and that this causes a shift in the mobility of WASp upon SDS-PAGE.
12200375 Platelets activate Arp2/3 complex, assemble actin, and change shape in the absence of WASp, indicating a more specialized role for WASp in these cells.
12196287 Wiskott-Aldrich Syndrome protein regulates lipid raft dynamics during immunological synapse formation
12177428 Required for NK cell cytotoxicity and colocalizes with actin to NK cell-activating immunologic synapses
12135674 Activation of Wiskott-Aldrich syndrome protein and its association with other proteins by stromal cell-derived factor-1alpha is associated with cell migration in Jurkat cells, a T-lymphocyte line.
12124997 Five novel WASP mutations have been identified that are all predicted to lead to premature translational termination of the WAS protein.
12073025 An Alu-mediated deletion at Xp11.23 leading to Wiskott-Aldrich syndrome.
11950596 Normal chemotactic responses were restored in WASp macrophages transfected with a full-length human WAS construct. Expression of exogenous WAS protein (WASp) in these cells also restored normal polarised cell morphology and the ability to form podosomes.
11877312 Missense mutations of the WASP gene cause intermittent X-linked thrombocytopenia
11793485 mutational analysis in patients with Wiskott-Aldrich syndrome in Argentina
11748279 WASp mediates actin polymerization and leads to ultimately to occupancy-induced TCR endocytosis

AA Sequence

MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCG      1 - 70
AVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRAL     71 - 140
VQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSS    141 - 210
RYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQ    211 - 280
LTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIA    281 - 350
PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV    351 - 420
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQ    421 - 490
AGDEDEDDEWDD                                                              491 - 502
//

Text Mined References (198)

PMID Year Title
26566883 2016 Homozygous missense mutation in the LMAN2L gene segregates with intellectual disability in a large consanguineous Pakistani family.
26463123 2015 Molecular difference between WASP and N-WASP critical for chemotaxis of T-cells towards SDF-1?.
26368308 2015 Lentiviral-mediated gene therapy restores B cell tolerance in Wiskott-Aldrich syndrome patients.
26277674 2015 Molecular characterization of two Malaysian patients with Wiskott-Aldrich syndrome.
26261240 2015 SUMOylation-disrupting WAS mutation converts WASp from a transcriptional activator to a repressor of NF-?B response genes in T cells.
26175287 2015 Analyses of Genetic and Clinical Parameters for Screening Patients With Inherited Thrombocytopenia with Small or Normal-Sized Platelets.
26159751 2015 Current and emerging treatment options for Wiskott-Aldrich syndrome.
26028144 2015 Platelet actin nodules are podosome-like structures dependent on Wiskott-Aldrich syndrome protein and ARP2/3 complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25931402 2015 Wiskott-Aldrich syndrome/X-linked thrombocytopenia in China: Clinical characteristic and genotype-phenotype correlation.
25416956 2014 A proteome-scale map of the human interactome network.
25413351 2015 Tyrosine phosphorylation of WIP releases bound WASP and impairs podosome assembly in macrophages.
25388447 2015 Hematopoietic Stem Cell Transplantation for X-Linked Thrombocytopenia With Mutations in the WAS gene.
25342748 2014 WASp family verprolin-homologous protein-2 (WAVE2) and Wiskott-Aldrich syndrome protein (WASp) engage in distinct downstream signaling interactions at the T cell antigen receptor site.
25277185 2014 High mobility group Box-1 inhibits cancer cell motility and metastasis by suppressing activation of transcription factor CREB and nWASP expression.
25253772 2014 Disruption of hSWI/SNF complexes in T cells by WAS mutations distinguishes X-linked thrombocytopenia from Wiskott-Aldrich syndrome.
25200405 2014 X-linked thrombocytopenia causing mutations in WASP (L46P and A47D) impair T cell chemotaxis.
25158122 2014 Synthetic variants of mycolactone bind and activate Wiskott-Aldrich syndrome proteins.
25154619 2014 X-linked thrombocytopenia in three males with normal sized platelets due to novel WAS gene mutations.
25115631 2015 Expression of Neural Wiskott-Aldrich Syndrome Protein in Clear Cell Renal Cell Carcinoma and Its Correlation with Clinicopathological Features.
24962707 2014 Triple-color FRET analysis reveals conformational changes in the WIP-WASp actin-regulating complex.
24945741 2014 Exacerbated experimental arthritis in Wiskott-Aldrich syndrome protein deficiency: modulatory role of regulatory B cells.
24872192 2014 Nuclear role of WASp in gene transcription is uncoupled from its ARP2/3-dependent cytoplasmic role in actin polymerization.
24440360 2014 Wiskott-Aldrich Syndrome causing mutation, Pro373Ser restricts conformational changes essential for WASP activity in T-cells.
24369837 2014 Wiskott-Aldrich Syndrome protein deficiency perturbs the homeostasis of B-cell compartment in humans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24133214 2013 Wiskott-Aldrich syndrome protein (WASp) controls the delivery of platelet transforming growth factor-?1.
24115682 2014 Intermittent X-linked thrombocytopenia with a novel WAS gene mutation.
23455509 2013 Dedicator of cytokinesis 8 interacts with talin and Wiskott-Aldrich syndrome protein to regulate NK cell cytotoxicity.
23301916 2013 Two cases of Wiskott-Aldrich syndrome in neonates due to gene mutations.
23264413 2012 Detection of six novel mutations in WASP gene in fifteen Iranian Wiskott-Aldrich patients.
23237501 2013 A novel Wiskott-Aldrich syndrome protein mutation in an infant with thrombotic thrombocytopenic purpura.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160469 2013 Disease-associated missense mutations in the EVH1 domain disrupt intrinsic WASp function causing dysregulated actin dynamics and impaired dendritic cell migration.
23119100 2012 Slit2N/Robo1 inhibit HIV-gp120-induced migration and podosome formation in immature dendritic cells by sequestering LSP1 and WASp.
22804504 2012 Wiskott-Aldrich syndrome protein controls antigen-presenting cell-driven CD4+ T-cell motility by regulating adhesion to intercellular adhesion molecule-1.
22665495 2012 Ubiquitylation-dependent negative regulation of WASp is essential for actin cytoskeleton dynamics.
22585739 2012 Wiskott-Aldrich syndrome protein (WASp) and N-WASp are involved in the regulation of NK-cell migration upon NKG2D activation.
22311461 2012 Impaired cell adhesion, apoptosis, and signaling in WASP gene-disrupted Nalm-6 pre-B cells and recovery of cell adhesion using a transducible form of WASp.
22038941 2012 IVS6+5G>A found in Wiskott-Aldrich syndrome and X-linked thrombocytopenia in a Korean family.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21711396 2011 The c.273+11dup genetic change in the WAS gene is a functionally neutral polymorphism.
21690559 2011 Cytoskeletal remodeling mediated by WASp in dendritic cells is necessary for normal immune synapse formation and T-cell priming.
21676863 2011 Arp2/3 complex is bound and activated by two WASP proteins.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21383498 2011 IL-2 induces a WAVE2-dependent pathway for actin reorganization that enables WASp-independent human NK cell function.
21269460 2011 Initial characterization of the human central proteome.
21185603 2011 Genetic characteristics of eighty-seven patients with the Wiskott-Aldrich syndrome.
21178275 2010 The Wiskott-Aldrich syndrome: The actin cytoskeleton and immune cell function.
20936779 2010 A human MAP kinase interactome.
20574068 2010 Nuclear role of WASp in the pathogenesis of dysregulated TH1 immunity in human Wiskott-Aldrich syndrome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20354175 2010 A congenital activating mutant of WASp causes altered plasma membrane topography and adhesion under flow in lymphocytes.
20232122 2010 Clinical aspects and genetic analysis of taiwanese patients with wiskott-Aldrich syndrome protein mutation: the first identification of x-linked thrombocytopenia in the chinese with novel mutations.
19859091 2009 Customised molecular diagnosis of primary immune deficiency disorders in New Zealand: an efficient strategy for a small developed country.
19817875 2009 Characterization of Wiskott-Aldrich syndrome (WAS) mutants using Saccharomyces cerevisiae.
19808890 2009 Regulation of podosome dynamics by WASp phosphorylation: implication in matrix degradation and chemotaxis in macrophages.
19798448 2009 Requirements for F-BAR proteins TOCA-1 and TOCA-2 in actin dynamics and membrane trafficking during Caenorhabditis elegans oocyte growth and embryonic epidermal morphogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19630517 2009 Was cDNA sequences modulate transgene expression of was promoter-driven lentiviral vectors.
19561083 2009 The mechanism of CSF-1-induced Wiskott-Aldrich syndrome protein activation in vivo: a role for phosphatidylinositol 3-kinase and Cdc42.
19487689 2009 Sorting nexin 33 induces mammalian cell micronucleated phenotype and actin polymerization by interacting with Wiskott-Aldrich syndrome protein.
19234535 2009 Src kinase Hck association with the WASp and mDia1 cytoskeletal regulators promotes chemoattractant-induced Hck membrane targeting and activation in neutrophils.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19155218 2009 FBP17 Mediates a Common Molecular Step in the Formation of Podosomes and Phagocytic Cups in Macrophages.
19006568 2009 A large kindred with X-linked neutropenia with an I294T mutation of the Wiskott-Aldrich syndrome gene.
18995840 2008 Hierarchical regulation of WASP/WAVE proteins.
18948384 2009 Active involvement of Robo1 and Robo4 in filopodia formation and endothelial cell motility mediated via WASP and other actin nucleation-promoting factors.
18941616 2008 Evolution of highly polymorphic T cell populations in siblings with the Wiskott-Aldrich Syndrome.
18654788 2008 Identification of a new WASP and FKBP-like (WAFL) protein in inflammatory bowel disease: a potential marker gene for ulcerative colitis.
18650809 2008 Structural mechanism of WASP activation by the enterohaemorrhagic E. coli effector EspF(U).
18332229 2008 Unprecedented diversity of genotypic revertants in lymphocytes of a patient with Wiskott-Aldrich syndrome.
18088087 2008 Phosphoproteome of resting human platelets.
18043243 2008 Wiskott-Aldrich syndrome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17890224 2007 Wiskott-Aldrich syndrome protein is a key regulator of the phagocytic cup formation in macrophages.
17724125 2007 Unregulated actin polymerization by WASp causes defects of mitosis and cytokinesis in X-linked neutropenia.
17719003 2007 Optimization of short hairpin RNA for lentiviral-mediated RNAi against WAS.
17711847 2007 Structure-function analysis of the WIP role in T cell receptor-stimulated NFAT activation: evidence that WIP-WASP dissociation is not required and that the WIP NH2 terminus is inhibitory.
17703096 2008 Clinical aspects and molecular analysis of Chinese patients with Wiskott-Aldrich syndrome in Taiwan.
17400488 Detection of 28 novel mutations in the Wiskott-Aldrich syndrome and X-linked thrombocytopenia based on multiplex PCR.
17390083 2007 Two novel mutations identified in the Wiskott-Aldrich syndrome protein gene cause Wiskott-Aldrich syndrome and thrombocytopenia.
17329259 2007 A hydrophobic pocket in the active site of glycolytic aldolase mediates interactions with Wiskott-Aldrich syndrome protein.
17296785 2007 WASP regulates suppressor activity of human and murine CD4(+)CD25(+)FOXP3(+) natural regulatory T cells.
17242350 2007 Interaction of the Wiskott-Aldrich syndrome protein with sorting nexin 9 is required for CD28 endocytosis and cosignaling in T cells.
17065640 2006 The genotype of the original Wiskott phenotype.
16901726 2006 Impaired integrin-dependent function in Wiskott-Aldrich syndrome protein-deficient murine and human neutrophils.
16804117 2006 Two novel activating mutations in the Wiskott-Aldrich syndrome protein result in congenital neutropenia.
16709815 2006 A complex of Wiskott-Aldrich syndrome protein with mammalian verprolins plays an important role in monocyte chemotaxis.
16582881 2006 Wiskott-Aldrich syndrome protein is involved in alphaIIb beta3-mediated cell adhesion.
16511828 2006 A second-site mutation in the initiation codon of WAS (WASP) results in expansion of subsets of lymphocytes in an Wiskott-Aldrich syndrome patient.
16488394 2006 WASP suppresses the growth defect of Saccharomyces cerevisiae las17Delta strain in the presence of WIP.
16372137 2006 A novel Wiskott-Aldrich syndrome protein (WASP) complex mutation identified in a WAS patient results in an aberrant product at the C-terminus from two transcripts with unusual polyA signals.
16360341 2006 A partial down-regulation of WASP is sufficient to inhibit podosome formation in dendritic cells.
16293614 2006 Protein-tyrosine kinase and GTPase signals cooperate to phosphorylate and activate Wiskott-Aldrich syndrome protein (WASP)/neuronal WASP.
16285728 2005 NMR analyses of the activation of the Arp2/3 complex by neuronal Wiskott-Aldrich syndrome protein.
16278221 2006 Characterization of an aldolase-binding site in the Wiskott-Aldrich syndrome protein.
16275905 2005 Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly.
16246732 2005 An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins.
16002738 2005 Genotype-proteotype linkage in the Wiskott-Aldrich syndrome.
15985539 2005 Mosaicism of NK cells in a patient with Wiskott-Aldrich syndrome.
15821030 2005 The nucleotide switch in Cdc42 modulates coupling between the GTPase-binding and allosteric equilibria of Wiskott-Aldrich syndrome protein.
15772651 2005 The DNA sequence of the human X chromosome.
15728466 2005 The Wiskott-Aldrich syndrome protein regulates nuclear translocation of NFAT2 and NF-kappa B (RelA) independently of its role in filamentous actin polymerization and actin cytoskeletal rearrangement.
15699074 2005 Dlgh1 coordinates actin polymerization, synaptic T cell receptor and lipid raft aggregation, and effector function in T cells.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15497008 2004 Molecular diagnosis of Wiskott-Aldrich syndrome in Taiwan.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469902 2004 Two novel mutations of Wiskott-Aldrich syndrome: the molecular prediction of interaction between the mutated WASP L101P with WASP-interacting protein by molecular modeling.
15389128 2004 A novel splice site mutation in the WAS gene causes Wiskott-Aldrich syndrome in two siblings of a Saudi family.
15361624 2004 Activation of endogenous Cdc42 visualized in living cells.
15235593 2004 Chemical inhibition of N-WASP by stabilization of a native autoinhibited conformation.
15169891 2004 Erk/Src phosphorylation of cortactin acts as a switch on-switch off mechanism that controls its ability to activate N-WASP.
15166239 2004 Syk-mediated tyrosine phosphorylation is required for the association of hematopoietic lineage cell-specific protein 1 with lipid rafts and B cell antigen receptor signalosome complex.
15130947 2004 Lymphocyte microvilli are dynamic, actin-dependent structures that do not require Wiskott-Aldrich syndrome protein (WASp) for their morphology.
15001467 2004 Impaired natural and CD16-mediated NK cell cytotoxicity in patients with WAS and XLT: ability of IL-2 to correct NK cell functional defect.
14707117 2004 Fyn and PTP-PEST-mediated regulation of Wiskott-Aldrich syndrome protein (WASp) tyrosine phosphorylation is required for coupling T cell antigen receptor engagement to WASp effector function and T cell activation.
14559906 2003 Regulation of SPIN90 phosphorylation and interaction with Nck by ERK and cell adhesion.
14504083 2004 Differential contribution of Wiskott-Aldrich syndrome protein to selective advantage in T- and B-cell lineages.
12969986 2004 Clinical course of patients with WASP gene mutations.
12872157 2003 A conserved amphipathic helix in WASP/Scar proteins is essential for activation of Arp2/3 complex.
12791263 2003 Regulation by phosphorylation. Yet another twist in the WASP story.
12769847 2003 Phosphorylation of the WASP-VCA domain increases its affinity for the Arp2/3 complex and enhances actin polymerization by WASP.
12769846 2003 Contingent phosphorylation/dephosphorylation provides a mechanism of molecular memory in WASP.
12727931 2003 Second-site mutation in the Wiskott-Aldrich syndrome (WAS) protein gene causes somatic mosaicism in two WAS siblings.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12591280 2003 X-linked thrombocytopenia caused by a mutation in the Wiskott-Aldrich syndrome (WAS) gene that disrupts interaction with the WAS protein (WASP)-interacting protein (WIP).
12530983 2003 The Wiskott-Aldrich syndrome protein acts downstream of CD2 and the CD2AP and PSTPIP1 adaptors to promote formation of the immunological synapse.
12504004 2002 Mechanism of recruitment of WASP to the immunological synapse and of its activation following TCR ligation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429845 2002 Motility determinants in WASP family proteins.
12351383 2002 Wiskott-Aldrich syndrome in a female.
12235133 2002 Phosphorylation of tyrosine 291 enhances the ability of WASp to stimulate actin polymerization and filopodium formation. Wiskott-Aldrich Syndrome protein.
12213210 2002 The WASP-binding protein WIRE has a role in the regulation of the actin filament system downstream of the platelet-derived growth factor receptor.
12200375 2002 Normal Arp2/3 complex activation in platelets lacking WASp.
12196287 2002 Wiskott-Aldrich syndrome protein regulates lipid raft dynamics during immunological synapse formation.
12177428 2002 Wiskott-Aldrich syndrome protein is required for NK cell cytotoxicity and colocalizes with actin to NK cell-activating immunologic synapses.
12135674 2002 Activation of Wiskott-Aldrich syndrome protein and its association with other proteins by stromal cell-derived factor-1alpha is associated with cell migration in a T-lymphocyte line.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11943145 2002 The acidic regions of WASp and N-WASP can synergize with CDC42Hs and Rac1 to induce filopodia and lamellipodia.
11877312 2002 Missense mutations of the WASP gene cause intermittent X-linked thrombocytopenia.
11793485 2002 Wiskott-Aldrich syndrome in Argentina: 17 unique, including nine novel, mutations.
11748279 2001 The intersectin 2 adaptor links Wiskott Aldrich Syndrome protein (WASp)-mediated actin polymerization to T cell antigen receptor endocytosis.
11721045 2001 Crystal structure of Arp2/3 complex.
11711533 2002 PSTPIP is a substrate of PTP-PEST and serves as a scaffold guiding PTP-PEST toward a specific dephosphorylation of WASP.
11598004 2001 A WASp-VASP complex regulates actin polymerization at the plasma membrane.
11340081 2001 Nck and phosphatidylinositol 4,5-bisphosphate synergistically activate actin polymerization through the N-WASP-Arp2/3 pathway.
11313252 2001 CrkL is an adapter for Wiskott-Aldrich syndrome protein and Syk.
11242115 2001 Constitutively activating mutation in WASP causes X-linked severe congenital neutropenia.
11167787 2001 Missense C168T in the Wiskott--Aldrich Syndrome protein gene is a common mutation in X-linked thrombocytopenia.
11146629 2001 Interaction of WASP/Scar proteins with actin and vertebrate Arp2/3 complex.
11052943 2000 Integration of multiple signals through cooperative regulation of the N-WASP-Arp2/3 complex.
10967094 2000 Characterization of TCL, a new GTPase of the rho family related to TC10 andCcdc42.
10861055 2000 The polarization defect of Wiskott-Aldrich syndrome macrophages is linked to dislocalization of the Arp2/3 complex.
10759756 2000 The Wiskott-Aldrich syndrome.
10747096 2000 Fyn-binding protein (Fyb)/SLP-76-associated protein (SLAP), Ena/vasodilator-stimulated phosphoprotein (VASP) proteins and the Arp2/3 complex link T cell receptor (TCR) signaling to the actin cytoskeleton.
10724160 2000 Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.
10713100 2000 Cdc42-interacting protein 4 mediates binding of the Wiskott-Aldrich syndrome protein to microtubules.
10563804 1999 Influence of the C terminus of Wiskott-Aldrich syndrome protein (WASp) and the Arp2/3 complex on actin polymerization.
10532312 1999 Interaction between Wiskott-Aldrich Syndrome protein (WASP) and the Fyn protein-tyrosine kinase.
10447259 1999 Novel mutations in the Wiskott-Aldrich syndrome protein gene and their effects on transcriptional, translational, and clinical phenotypes.
10381382 1999 Identification of two human WAVE/SCAR homologues as general actin regulatory molecules which associate with the Arp2/3 complex.
10360578 1999 Structure of Cdc42 in complex with the GTPase-binding domain of the 'Wiskott-Aldrich syndrome' protein.
10358777 1999 The Wiskott-Aldrich syndrome protein (WASP): roles in signaling and cytoskeletal organization.
10224664 Wiskott-Aldrich syndrome protein, WASP.
10202051 1999 Mutations that cause the Wiskott-Aldrich syndrome impair the interaction of Wiskott-Aldrich syndrome protein (WASP) with WASP interacting protein.
10068673 1999 Involvement of wiskott-aldrich syndrome protein in B-cell cytoplasmic tyrosine kinase pathway.
10066431 1999 The identification and characterization of two promoters and the complete genomic sequence for the Wiskott-Aldrich syndrome gene.
9742969 1998 Tyrosine phosphorylation of the Wiskott-Aldrich syndrome protein by Lyn and Btk is regulated by CDC42.
9713366 1998 Defective actin polymerization in EBV-transformed B-cell lines from patients with the Wiskott-Aldrich syndrome.
9683546 1998 Absence of expression of the Wiskott-Aldrich syndrome protein in peripheral blood cells of Wiskott-Aldrich syndrome patients.
9660763 1998 The Cdc42/Rac interactive binding region motif of the Wiskott Aldrich syndrome protein (WASP) is necessary but not sufficient for tight binding to Cdc42 and structure formation.
9488710 1998 Tyrosine phosphorylation regulates the SH3-mediated binding of the Wiskott-Aldrich syndrome protein to PSTPIP, a cytoskeletal-associated protein.
9445409 1998 X-linked Wiskott-Aldrich syndrome in a girl.
9422512 1998 Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP.
9405671 1997 WIP, a protein associated with wiskott-aldrich syndrome protein, induces actin polymerization and redistribution in lymphoid cells.
9307968 1997 Wiskott-Aldrich syndrome protein is associated with the adapter protein Grb2 and the epidermal growth factor receptor in living cells.
9126958 1997 Variable expression of WASP in B cell lines of Wiskott-Aldrich syndrome patients.
9098856 1997 Mutation analysis of five Japanese families with Wiskott-Aldrich syndrome and determination of the family members' carrier status using three different methods.
8892607 1996 Evidence that the Wiskott-Aldrich syndrome protein may be involved in lymphoid cell signaling pathways.
8824280 1996 Identification of regions of the Wiskott-Aldrich syndrome protein responsible for association with selected Src homology 3 domains.
8810341 1996 Identification of Itk/Tsk Src homology 3 domain ligands.
8805332 1996 Wiskott-Aldrich syndrome protein (WASp) is a binding partner for c-Src family protein-tyrosine kinases.
8805223 1996 Two GTPases, Cdc42 and Rac, bind directly to a protein implicated in the immunodeficiency disorder Wiskott-Aldrich syndrome.
8757563 1996 Isolated X-linked thrombocytopenia in two unrelated families is associated with point mutations in the Wiskott-Aldrich syndrome protein gene.
8682510 1996 Wiskott-Aldrich syndrome: no strict genotype-phenotype correlations but clustering of missense mutations in the amino-terminal part of the WASP gene product.
8643625 1996 Direct interaction of the Wiskott-Aldrich syndrome protein with the GTPase Cdc42.
8625410 1996 Wiskott-Aldrich syndrome protein, a novel effector for the GTPase CDC42Hs, is implicated in actin polymerization.
8528199 1995 WASP gene mutations in Wiskott-Aldrich syndrome and X-linked thrombocytopenia.
8528198 1995 Identification of WASP mutations in patients with Wiskott-Aldrich syndrome and isolated thrombocytopenia reveals allelic heterogeneity at the WAS locus.
8069912 1994 Isolation of a novel gene mutated in Wiskott-Aldrich syndrome.
8001129 1994 Isolation of a novel gene mutated in Wiskott-Aldrich syndrome.
7795648 1995 X-linked thrombocytopenia and Wiskott-Aldrich syndrome are allelic diseases with mutations in the WASP gene.
7753869 1995 Identification of mutations in the Wiskott-Aldrich syndrome gene and characterization of a polymorphic dinucleotide repeat at DXS6940, adjacent to the disease gene.
7565724 1995 Wiskott-Aldrich syndrome protein physically associates with Nck through Src homology 3 domains.
4161668 1965 Inherited thrombocytopenia.
2904289 1988 Hereditary X-linked thrombocytopenia maps to the same chromosomal region as the Wiskott-Aldrich syndrome.