Property Summary

NCBI Gene PubMed Count 193
PubMed Score 1242.06
PubTator Score 776.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7950 1.0e-06
malignant mesothelioma 3232 3.5e-06
psoriasis 6694 1.7e-05
cutaneous lupus erythematosus 1057 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 1.9e-03
malignant mesothelioma 2.100 3.5e-06
osteosarcoma -3.511 1.0e-06
psoriasis 2.700 1.7e-05

Protein-protein Interaction (5)

Gene RIF (118)

AA Sequence

MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCG      1 - 70
AVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRAL     71 - 140
VQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSS    141 - 210
RYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQ    211 - 280
LTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIA    281 - 350
PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV    351 - 420
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQ    421 - 490
AGDEDEDDEWDD                                                              491 - 502
//

Text Mined References (206)

PMID Year Title