Property Summary

NCBI Gene PubMed Count 165
PubMed Score 1859.38
PubTator Score 1551.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 3.100 1.1e-16

 GWAS Trait (1)

Gene RIF (100)

PMID Text
26709396 We confirmed increased levels of C1R and VTN in sera from patients with Joint hypermobility syndrome by western blot analyses
26617861 High expression of VN in tumor cells independently indicated poor clinical prognosis in patients with osteosarcoma.
26572616 Bacterial protein-E and host vitronectin play a role in the attachment to bronchial epithelial cells and is also involved in the subsequent intracellular invasion of nontypeable Haemophilus influenzae.
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26377177 Ail-expressing Yersinia pestis strains bind vitronectin - a host protein with functions in cell attachment, fibrinolysis and inhibition of the complement system.
26368530 Lpd of P. aeruginosa is a surface exposed moonlighting protein that binds two human terminal pathway inhibitors, vitronectin and clusterin
26101327 Vitronectin is identified as a common constituent of amyloid deposits in 175 formalin-fixed and paraffin-embedded tissue samples from a large variety of different amyloid diseases.
26047937 P. aeruginosa isolates obtained from CF patients significantly bound vitronectin. Porin D was defined as a novel P. aeruginosa vitronectin-receptor
25768308 Vitronectin expression in the airways of subjects with asthma and chronic obstructive pulmonary disease
25374123 A total of 17 site-specific N-glycopeptides were completely identified in all of the three N-glycosylation sites of vitronectin in human plasma, including 12 N-glycopeptides first reported.
25181963 Hic interacts with vitronectin and simultaneously with Factor H, and both human proteins may contribute to colonisation and invasive disease caused by serotype 3 pneumococci.
25179307 VTN plays a significant role in the malignant growth of tumor.
25168639 The interaction between uPAR and vitronectin triggers ligand-independent adhesion signalling by integrins.
24999757 serum levels of both fibronectin and vitronectin may be the diagnostic markers in melanoma patients, but not markers of prognosis
24823429 The VN level may be relevant as a clinical biomarker for adverse cardiovascular outcomes not only in patients with ischemic heart disease undergoing coronary interventions.
24770328 The mean level of PAI-1 was 23.02 +/- 15 (8.2-71.19) ng/mL and vitronectin was 83.10% +/- 23.77% (12%-126%) in the tumor group.
24687613 Melanoma cell adhesion to vitronectin is dependent on beta-1,6-branched N-glycans.
24625558 Gpm1 in Candida albicans attaches to human endothelial cells and to keratinocytes via the adhesive protein vitronectin
24603119 Report role of vitronectin in the regulation of angiogenesis induced by VEGF.
24371140 Vn competes with hTSP-1 for binding to Atl repeats and vice versa. In conclusion, this study identifies the Atl repeats as bacterial adhesive structures interacting with the human glycoproteins hTSP-1 and Vn.
24286496 Authors demonstrate that an evolutionarily conserved rickettsial antigen, Adr1/RC1281, interacts with human vitronectin and is sufficient to mediate resistance to serum killing when expressed at the outer-membrane.
23899674 The presence of VN on the material surfaces enhanced cell-mediated FN reorganization and secretion.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of vitronectin (VTN) expression as compared to untreated control
23811340 study highlights that ascites-derived fibronectin and vitronectin exhibit different properties depending on the ascites
23722547 Interaction of vitronectin with integrin alphavbeta3 results in the continued activation of the kinase mTOR.
23603906 The choline-binding protein PspC of Streptococcus pneumoniae interacts with the C-terminal heparin-binding domain of vitronectin.
23474333 In conclusion, the head domains of UspA2/2H have extensive sequence polymorphism without losing vitronectin-binding capacity promoting a general evasion of the host immune system.
23387957 An isogenic nontypeable Haemophilus influenzae 3655Deltahpf mutant devoid of protein F displayed a reduced binding of vitronectin, and was consequently more sensitive to killing by human serum compared with the wild type.
23327926 Importance of vitronectin and its interaction with the urokinase receptor in tumor growth.
23124223 increased expression levels of VN protein and mRNA in placental maternal-fetal interface of EOSP may be involved in adhesion and repair of placental infarct lesions.
23041018 A strong linkage disequilibrium was found in vitronectin promoter in Chinese with vascular disease.
22810367 There was no difference in serum vitronectin levels between Behcet's disease patients and control subjects, and there was no statistically significant difference between vitronectin levels in Behcet patients with and without ocular involvement.
22050461 In this study, the authors demonstrate meningococcal interactions with vitronectin via a novel adhesin, Msf (meningococcal surface fibril, previously NhhA or Hsf).
21800006 higgh plasms levels is associated with the risk of metabolic syndrome and type 2 diabetes mellitus
21542857 A series of truncated vitronectin molecules revealed that the C-terminal domain comprising vitronectin(353-363) harboured the major binding region for Haemophilus influenzae protein E.
21316840 PAI-2 is capable of inhibiting uPA in the presence of PAI-1, particularly on adherent cells in the presence of vitronectin
21253761 High serum vitronectin is associated with breast cancer.
21193465 Thrombospondin 1, fibronectin, and vitronectin are differentially dependent upon RAS, ERK1/2, and p38 for induction of vascular smooth muscle cell chemotaxis.
21048021 The results provide the first evidence for vitronectin gene expression in urothelial cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600001 A fragment of vitronectin containing the RGD integrin binding site showed similar binding affinity as that of full vitronectin protein to purified integrin alphavbeta3 but had diminished cell adhesion and spreading function in vivo.
20502634 Neisseria meningitidis Opc expressed in acapsulate as well as capsulate bacteria can increase human brain endothelial cell line adhesion and entry by first binding to serum vitronectin
20492459 Plasminogen activator inhibitor-1 and vitronectin expression level and stoichiometry regulate vascular smooth muscle cell migration through physiological collagen matrices
20358426 Initial formation of IGROV1 ovarian cancer multicellular aggregates involves vitronectin.
20199596 This study directly reveals the binding mode between the N-terminal domain of UspA2 Moraxella catarrhalis and the C-terminal part of vitronectin and thus sheds light upon the mechanism of Moraxella catarrhalis-dependent serum resistance.
20195466 Data reveal that multimeric VTNC attenuate Cyr61 binding to immobilized VTNC, while monomeric VTNC was ineffective.
20121701 expression of vitronectin at the periphery of mesothelial cells and within ovarian cancer cell clusters suggests a potential role for this molecule during intraperitoneal implantation of ovarian cancer cells
20066177 results suggest that in two metastatic cell lines integrin-linked N-oligosaccharides influence the VN adhesion receptor activity and function.
20031688 Vitronectin may be an independent predictor of adverse cardiovascular outcomes following acute stenting in acute coronary syndromes.
19998373 Here we show that vitronectin is the component of human serum driving stem cell differentiation through an integrin alpha V beta 3-dependent mechanism.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19893454 Data show that the expression of collagen types I, III and fibronectin was significantly higher in pancreatic cancer, and the expression of collagen type IV, laminin and vitronectin was significantly lower in pancreatic cancer.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19657137 Report differences in proteolytic processing of vitronectin and/or high molecular weight kininogen in women who develop preeclampsia.
19635912 Vitronectin mediates a protective role at the bacterial surface by binding to nontypeable Haemophilus influenzae 3655 and reducing membrane attack complex (MAC)-induced hemolysis.
19408099 Low levels of serum vitronectin is associated with febrile phase, hypotensive and oliguric phases in patients with hemorrhagic fever with renal syndrome.
19288063 A vitronectin M381T polymorphism increases risk of hemangioblastoma in patients with VHL gene defect
19193026 These results support a model for PAI-1 binding to vitronectin in which the interaction surface extends beyond the region of PAI-1 occupied by the SMB domain.
19162023 support the beneficial effect of VN on oligodendrocytic differentiation of human embryonic stem cells
19118218 pneumococci exploit the vitronectin-alphavbeta3-integrin complex as a cellular receptor for invasion and this integrin-mediated internalization requires the cooperation between the host signalling molecules ILK, PI3K and Akt.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18781095 ability of ovarian carcinoma cells to bind to peritoneal mesothelium in vitro and strongly suggest that vitronectin and its receptors contribute to this crucial event.
18658131 analysis of a site on PAI-1 that binds to vitronectin outside of the somatomedin B domain
18516040 vitronectin and integrin beta(3) contribute to the initiation of TLR2 responses
18376415 reports the crystal structures of uPAR in complex with both urokinase (uPA) and vitronectin and reveal that uPA occupies the central cavity of the receptor, whereas vitronectin binds at the outer side of the receptor
18362146 A composite role of vitronectin and urokinase in the modulation of cell morphology upon expression of the urokinase receptor.
18340378 MMP-2 enhanced peritoneal adhesion of ovarian cancer cells through cleavage of ECM proteins fibronectin (FN) and vitronectin (Vn) into small fragments
18200066 Vitronectin and growth factor complexes way have roles in wound healing
18174166 vitronectin without the somatomedin B domain exhibits residual plasminogen activator inhibitor-1-binding activity
17766387 Solution structure of recombinant somatomedin B domain from VN produced in Pichia pastoris is reported.
17344041 PLAUR and the somatomedin B region of VTN direct the localization of UPA to focal adhesions in microvessel endothelial cells.
16815299 Osteogenesis on vitronectin correlated with enhanced focal adhesion formation, the activation of focal adhesion kinase (FAK) and paxillin, and the diminished activation of extracellular signal-regulated kinase (ERK).
16785539 Binding of vitronectin to outer membrane protein Haemophilus influenzae type b surface fibrils (Hsf) inhibits complement-mediated bactericidal activity and prevents complement-induced cell lysis.
15914035 IGROV1 cells were shown to adhere rapidly on the HUVECs monolayer; adhesion was inhibited by anti-alphav integrin and anti-Vn blocking antibodies, but not by anti-beta1 integrin antibodies
15905170 Complexation wiwth serpin peptidase inibitor (PAI-1), with a sedimentation coefficient of 6.5 S, is the key intermediate for the assembly of higher order complexes.
15843372 examination of the mechanism by which granzyme B cleaves vitronectin
15777802 Vittronectin can enhance epidermal growth factor and basic fibroblast growth factor ) to enhance keratinocyte cell division.
15717924 Through promoting Met-Integrin association, HGF-FN and HGF-VN complexes coordinated and enhanced endothelial cell migration through activation of the PI-3 kinase pathway involving a Ras-dependent mechanism
15641781 Structural model provides an indication of the disposition of the central domain and C-terminal heparin-binding domains of vitronectin with respect to the N-terminal somatomedin B domain.
15140223 IGF-II:VN and IGF-I:IGFBP-5:VN complexes may be useful in situations where enhanced keratinocyte cell migration and proliferation is required, such as in wound healing and skin regeneration.
15123885 Human mesenchymal stem cells cultured on purified vitronectin produce a mineralized matrix, and express osteopontin, osteocalcin, collagen I, and alkaline phosphatase.
15123712 Results describe the three-dimensional structure of an N-terminal fragment comprising the first 51 amino acids from human plasma vitronectin.
15069014 VN-potentiated platelet-clot interaction requires VN in the clot and multimeric VN bound to the platelet surface; self-assembly of VTN may provide a physiologically relevant contribution to platelet aggregation on a blood clot.
14681059 Turnover of soluble vitronectin requires ligation of vitronectin's basic domain and that this binding event can work in trans to regulate vitronectin degradation.
14586734 Results indicate that multimeric vitronectin in encapsulating peritoneal sclerosis (EPS)ascites plays a potential role in peritoneal fibrogenesis in EPS.
12913402 Plasma vitronectin level potentially represents a pathogenic factor for atherogenesis and thrombus formation in patients with coronary artery disease.
12810534 importance of IGFBPs in modulating IGF-I binding to VN and that this binding has functional consequences in cells.
12757937 strong vitronectin accumulation in extracellular matrix around some breast cancer cell clusters and in the subendothelial area of some blood vessels
12437099 REVIEW: studies defining the binding sites of vitronectin and PAI-1 and binding affinities in the formation of larger PAI-1/VTN complexes.
12091360 Adhesion of hairy cells to vitronectin inhibits interferon-alpha-induced apoptosis.
12071840 demonstrated that the avidity of heparin binding to vitronectin is governed by both the conformational state of the monomer and multimerization of the molecule
12019263 the rSMB domain of vitronectin is distinct from the crossed pattern present in most small disulfide bond-rich proteins
11864711 Snake venom disintegrin, saxatilin, inhibits interaction of human umbilical vein cells to immobilized vitronectin and adhesion of smooth muscle cells to vitronectin as well as vitronectin-induced migration of the SMC cells.
11796716 Plasminogen activator inhibitor type 1 promotes the self-association of vitronectin into complexes
11785953 Mapped the fibrin binding sites in vitronectin
11756447 uPA-dependent VSMC adhesion is a function of selective Vn phosphorylation by the ectoprotein kinase CK2
11744726 studies reveal that vitronectin associates with fibrin during coagulation, and may thereby modulate hemostasis and inflammation
7690138 HIV-1 gp120-treated vaginal epithelial cells show upregulation of vitronectin (VTN) expression as compared to untreated control
7682219 HIV-1 gp120-treated vaginal epithelial cells show upregulation of vitronectin (VTN) expression as compared to untreated control
7522689 HIV-1 gp120-treated vaginal epithelial cells show upregulation of vitronectin (VTN) expression as compared to untreated control

AA Sequence

MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTM      1 - 70
PEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPE     71 - 140
TLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAF    141 - 210
TRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYW    211 - 280
EYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAM    281 - 350
AGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY    351 - 420
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL                421 - 478
//

Text Mined References (174)

PMID Year Title
26709396 2016 Proteomic analysis for the identification of serum diagnostic markers for joint hypermobility syndrome.
26617861 2015 Vitronectin significantly influences prognosis in osteosarcoma.
26572616 2015 Nontypeable Haemophilus influenzae exploits the interaction between protein-E and vitronectin for the adherence and invasion to bronchial epithelial cells.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26538390 2015 Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells.
26377177 2015 Yersinia pestis uses the Ail outer membrane protein to recruit vitronectin.
26368530 2015 Pseudomonas aeruginosa Uses Dihydrolipoamide Dehydrogenase (Lpd) to Bind to the Human Terminal Pathway Regulators Vitronectin and Clusterin to Inhibit Terminal Pathway Complement Attack.
26101327 2015 MALDI-mass spectrometry imaging identifies vitronectin as a common constituent of amyloid deposits.
26047937 2015 Identification of outer membrane Porin D as a vitronectin-binding factor in cystic fibrosis clinical isolates of Pseudomonas aeruginosa.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25768308 2015 Vitronectin expression in the airways of subjects with asthma and chronic obstructive pulmonary disease.
25416956 2014 A proteome-scale map of the human interactome network.
25374123 2014 In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation.
25181963 2015 Binding of vitronectin and Factor H to Hic contributes to immune evasion of Streptococcus pneumoniae serotype 3.
25179307 2015 Vitronectin silencing inhibits hepatocellular carcinoma in vitro and in vivo.
25168639 2014 The interaction between uPAR and vitronectin triggers ligand-independent adhesion signalling by integrins.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24999757 2014 Clinical significance of serum fibronectin and vitronectin levels in melanoma patients.
24823429 2015 Prognostic utility of serum vitronectin levels in acute myocardial infarction.
24770328 2016 Plasma Levels of Plasminogen Activator Inhibitor Type 1 and Vitronectin in Children With Cancer.
24687613 2014 Studies on primary uveal and cutaneous melanoma cell interaction with vitronectin.
24625558 2014 Candida albicans uses the surface protein Gpm1 to attach to human endothelial cells and to keratinocytes via the adhesive protein vitronectin.
24603119 2014 Vitronectin regulation of vascular endothelial growth factor-mediated angiogenesis.
24371140 2014 Repeating structures of the major staphylococcal autolysin are essential for the interaction with human thrombospondin 1 and vitronectin.
24286496 2014 Pathogenic Rickettsia species acquire vitronectin from human serum to promote resistance to complement-mediated killing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23899674 2013 Vitronectin alters fibronectin organization at the cell-material interface.
23811340 2013 Ovarian cancer ascites-derived vitronectin and fibronectin: combined purification, molecular features and effects on cell response.
23722547 2013 Vitronectin-?v?3 integrin engagement directs hypoxia-resistant mTOR activity and sustained protein synthesis linked to invasion by breast cancer cells.
23603906 2013 The choline-binding protein PspC of Streptococcus pneumoniae interacts with the C-terminal heparin-binding domain of vitronectin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23474333 2013 Impact of sequence diversity in the Moraxella catarrhalis UspA2/UspA2H head domain on vitronectin binding and antigenic variation.
23387957 2013 Haemophilus influenzae acquires vitronectin via the ubiquitous Protein F to subvert host innate immunity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23327926 2013 Direct evidence of the importance of vitronectin and its interaction with the urokinase receptor in tumor growth.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23124223 2013 Increased expression levels of vitronectin in the maternal?fetal interface of placenta in early-onset severe preeclampsia.
23041018 2013 Promoter variants of VTN are associated with vascular disease.
22810367 2012 Serum vitronectin levels in patients with Behçet's disease.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22505472 2012 Exosome release of ADAM15 and the functional implications of human macrophage-derived ADAM15 exosomes.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22050461 2011 Meningococcal surface fibril (Msf) binds to activated vitronectin and inhibits the terminal complement pathway to increase serum resistance.
21800006 2011 Association of vitronectin and plasminogen activator inhibitor-1 levels with the risk of metabolic syndrome and type 2 diabetes mellitus. Results from the D.E.S.I.R. prospective cohort.
21542857 2011 Haemophilus influenzae protein E recognizes the C-terminal domain of vitronectin and modulates the membrane attack complex.
21316840 2011 Molecular competition between plasminogen activator inhibitors type -1 and -2 for urokinase: Implications for cellular proteolysis and adhesion in cancer.
21269460 2011 Initial characterization of the human central proteome.
21253761 2011 Identification of vitronectin as a novel serum marker for early breast cancer detection using a new proteomic approach.
21193465 2011 Thrombospondin 1, fibronectin, and vitronectin are differentially dependent upon RAS, ERK1/2, and p38 for induction of vascular smooth muscle cell chemotaxis.
21048021 2011 Dual sources of vitronectin in the human lower urinary tract: synthesis by urothelium vs. extravasation from the bloodstream.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600001 2010 Heparin binding domain in vitronectin is required for oligomerization and thus enhances integrin mediated cell adhesion and spreading.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20502634 2010 Neisseria meningitidis Opc invasin binds to the sulphated tyrosines of activated vitronectin to attach to and invade human brain endothelial cells.
20492459 2010 Plasminogen activator inhibitor-1 and vitronectin expression level and stoichiometry regulate vascular smooth muscle cell migration through physiological collagen matrices.
20358426 2010 Initial formation of IGROV1 ovarian cancer multicellular aggregates involves vitronectin.
20199596 2010 Vitronectin binds to the head region of Moraxella catarrhalis ubiquitous surface protein A2 and confers complement-inhibitory activity.
20195466 2010 Cyr61/CCN1 displays high-affinity binding to the somatomedin B(1-44) domain of vitronectin.
20121701 2010 Mesothelial vitronectin stimulates migration of ovarian cancer cells.
20066177 2010 Effect of alpha3beta1 and alphavbeta3 integrin glycosylation on interaction of melanoma cells with vitronectin.
20031688 2009 Vitronectin concentrations predict risk in patients undergoing coronary stenting.
19998373 2010 Identification of vitronectin as an extrinsic inducer of cancer stem cell differentiation and tumor formation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19893454 2009 Promotion of tumor cell migration by extracellular matrix proteins in human pancreatic cancer.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19657137 2009 Aberrant processing of plasma vitronectin and high-molecular-weight kininogen precedes the onset of preeclampsia.
19635912 2009 Nontypeable Haemophilus influenzae protein E binds vitronectin and is important for serum resistance.
19408099 2009 Low levels of serum vitronectin associated with clinical phases in patients with hemorrhagic fever with renal syndrome.
19288063 2009 A vitronectin M381T polymorphism increases risk of hemangioblastoma in patients with VHL gene defect.
19267251 2009 Cooperation between integrin alphavbeta3 and VEGFR2 in angiogenesis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19193026 2009 Interactions of plasminogen activator inhibitor-1 with vitronectin involve an extensive binding surface and induce mutual conformational rearrangements.
19162023 2009 Vitronectin promotes oligodendrocyte differentiation during neurogenesis of human embryonic stem cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19118218 2009 Integrin-linked kinase is required for vitronectin-mediated internalization of Streptococcus pneumoniae by host cells.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18781095 2008 Vitronectin and its receptors partly mediate adhesion of ovarian cancer cells to peritoneal mesothelium in vitro.
18658131 2008 Characterization of a site on PAI-1 that binds to vitronectin outside of the somatomedin B domain.
18516040 2008 A Toll-like receptor 2-integrin beta3 complex senses bacterial lipopeptides via vitronectin.
18376415 2008 Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes.
18362146 2008 A composite role of vitronectin and urokinase in the modulation of cell morphology upon expression of the urokinase receptor.
18340378 2008 The initial steps of ovarian cancer cell metastasis are mediated by MMP-2 cleavage of vitronectin and fibronectin.
18200066 2008 Vitronectin: growth factor complexes hold potential as a wound therapy approach.
18174166 2008 A deletion mutant of vitronectin lacking the somatomedin B domain exhibits residual plasminogen activator inhibitor-1-binding activity.
18088087 2008 Phosphoproteome of resting human platelets.
17766387 2007 Solution structure of recombinant somatomedin B domain from vitronectin produced in Pichia pastoris.
17558413 2007 Determination of the sites of tyrosine O-sulfation in peptides and proteins.
17344041 2007 The uPA receptor and the somatomedin B region of vitronectin direct the localization of uPA to focal adhesions in microvessel endothelial cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16815299 2006 Vitronectin and collagen I differentially regulate osteogenesis in mesenchymal stem cells.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16785539 2006 Haemophilus influenzae surface fibrils contribute to serum resistance by interacting with vitronectin.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
15914035 2005 Adhesion of human ovarian adenocarcinoma IGROV1 cells to endothelial cells is partly mediated by the alphav integrins-vitronectin adhesive system and induces an alteration of endothelial integrity.
15905170 2005 A mechanism for assembly of complexes of vitronectin and plasminogen activator inhibitor-1 from sedimentation velocity analysis.
15843372 2005 Extracellular matrix remodeling by human granzyme B via cleavage of vitronectin, fibronectin, and laminin.
15777802 2005 Responses of keratinocytes to substrate-bound vitronectin: growth factor complexes.
15717924 2005 Novel hepatocyte growth factor (HGF) binding domains on fibronectin and vitronectin coordinate a distinct and amplified Met-integrin induced signalling pathway in endothelial cells.
15641781 2005 A model for the three-dimensional structure of human plasma vitronectin from small-angle scattering measurements.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140223 2004 Insulin-like growth factors (IGF) and IGF-binding proteins bound to vitronectin enhance keratinocyte protein synthesis and migration.
15123885 2004 Adhesion to Vitronectin and Collagen I Promotes Osteogenic Differentiation of Human Mesenchymal Stem Cells.
15123712 2004 The solution structure of the N-terminal domain of human vitronectin: proximal sites that regulate fibrinolysis and cell migration.
15069014 2004 Fibrin-incorporated vitronectin is involved in platelet adhesion and thrombus formation through homotypic interactions with platelet-associated vitronectin.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14681059 Vitronectin's basic domain is a syndecan ligand which functions in trans to regulate vitronectin turnover.
14586734 2003 Multimeric vitronectin in ascites is involved in fibroblast spreading of EPS in patients on CAPD therapy.
12913402 2002 Plasma vitronectin levels in patients with coronary atherosclerosis are increased and correlate with extent of disease.
12810534 2003 Structural and functional evidence for the interaction of insulin-like growth factors (IGFs) and IGF binding proteins with vitronectin.
12808446 2003 How vitronectin binds PAI-1 to modulate fibrinolysis and cell migration.
12757937 2003 Vitronectin in human breast carcinomas.
12565847 2003 Amphiphysin1 inhibits vitronectin-mediated cell adhesion, spreading, and migration in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437099 Interaction of plasminogen activator inhibitor type-1 (PAI-1) with vitronectin (Vn): mapping the binding sites on PAI-1 and Vn.
12091360 2002 Response of hairy cells to IFN-alpha involves induction of apoptosis through autocrine TNF-alpha and protection by adhesion.
12071840 2002 New insights into heparin binding to vitronectin: studies with monoclonal antibodies.
12019263 2002 Identification of the disulfide bonds in the recombinant somatomedin B domain of human vitronectin.
11864711 2002 Snake venom disintegrin, saxatilin, inhibits platelet aggregation, human umbilical vein endothelial cell proliferation, and smooth muscle cell migration.
11796824 2002 Molecular interactions and functional interference between vitronectin and transforming growth factor-beta.
11796716 2002 Plasminogen activator inhibitor type 1 promotes the self-association of vitronectin into complexes exhibiting altered incorporation into the extracellular matrix.
11756447 2002 Urokinase-dependent human vascular smooth muscle cell adhesion requires selective vitronectin phosphorylation by ectoprotein kinase CK2.
11751588 2002 Vitronectin binding to IGF binding protein-5 (IGFBP-5) alters IGFBP-5 modulation of IGF-I actions.
11744726 2002 Incorporation of vitronectin into fibrin clots. Evidence for a binding interaction between vitronectin and gamma A/gamma' fibrinogen.
11437656 2001 The poliovirus receptor CD155 mediates cell-to-matrix contacts by specifically binding to vitronectin.
11419941 2001 cDNA and genomic cloning of lacritin, a novel secretion enhancing factor from the human lacrimal gland.
10887113 2000 Different mechanisms define the antiadhesive function of high molecular weight kininogen in integrin- and urokinase receptor-dependent interactions.
10835423 2000 Substrate specificity of alpha(v)beta(3) integrin-mediated cell migration and phosphatidylinositol 3-kinase/AKT pathway activation.
10586957 1999 Vitronectin gene expression in the adult human retina.
10342887 1999 Identification of vitronectin as a novel insulin-like growth factor-II binding protein.
10329419 1999 The human retina and retinal pigment epithelium are abundant sources of vitronectin mRNA.
10022831 1999 Role of alphavbeta3 integrin in the activation of vascular endothelial growth factor receptor-2.
9733784 1998 Phosphorylation of vitronectin by casein kinase II. Identification of the sites and their promotion of cell adhesion and spreading.
9718986 1998 Vitronectin expression in Purkinje cells in the human cerebellum.
9443892 1998 The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.
9151113 1997 Localization of vitronectin in the normal and atherosclerotic human vessel wall.
9030777 1997 Phosphorylation of vitronectin on Ser362 by protein kinase C attenuates its cleavage by plasmin.
8920805 Vitronectin modulates the expression of complement components of the terminal pathway synthesized by human umbilical vein endothelial cells in vitro.
8900153 1996 The binding protein for globular heads of complement C1q, gC1qR. Functional expression and characterization as a novel vitronectin binding factor.
8837777 1996 The serpin PAI-1 inhibits cell migration by blocking integrin alpha V beta 3 binding to vitronectin.
8830783 1996 Is plasminogen activator inhibitor-1 the molecular switch that governs urokinase receptor-mediated cell adhesion and release?
8663085 1996 Characterization of the denaturation and renaturation of human plasma vitronectin. II. Investigation into the mechanism of formation of multimers.
8626514 1996 Plasminogen activator inhibitor-1 and vitronectin promote the cellular clearance of thrombin by low density lipoprotein receptor-related proteins 1 and 2.
8567871 1995 PCR-amplified vitronectin mRNA localizes in situ to spermatocytes and round spermatids in the human testis.
7690138 1993 The Tat protein of human immunodeficiency virus type 1, a growth factor for AIDS Kaposi sarcoma and cytokine-activated vascular cells, induces adhesion of the same cell types by using integrin receptors recognizing the RGD amino acid sequence.
7682219 1993 A novel integrin specificity exemplified by binding of the alpha v beta 5 integrin to the basic domain of the HIV Tat protein and vitronectin.
7545318 1995 Inhibition of thrombin by antithrombin III and heparin cofactor II in vivo.
7522053 1994 Identification of a PAI-1 binding site in vitronectin.
7518183 1994 Vitronectin in human tears--protection against closed eye induced inflammatory damage.
7490129 1995 Extracellular matrix proteins and integrin receptors in reactive and non-reactive lymph nodes.
6210287 1984 Domain structure of vitronectin. Alignment of active sites.
3004934 1985 Molecular cloning of S-protein, a link between complement, coagulation and cell-substrate adhesion.
2479556 1989 Sulfation of two tyrosine-residues in human complement S-protein (vitronectin).
2475499 1989 A novel beta-endorphin binding protein. Complement S protein (= vitronectin) exhibits specific non-opioid binding sites for beta-endorphin upon interaction with heparin or surfaces.
2454751 1988 Three types of vitronectin in human blood.
2448300 1988 Phosphorylation of vitronectin by a protein kinase in human plasma. Identification of a unique phosphorylation site in the heparin-binding domain.
2447940 1987 Nucleotide sequence and organization of the human S-protein gene: repeating peptide motifs in the "pexin" family and a model for their evolution.
2433863 1986 Localization of vitronectin (S-protein of complement) in normal human skin.
2418831 1986 Physicochemical, immunochemical and functional comparison of human S-protein and vitronectin. Evidence for the identity of both plasma proteins.
2414098 1985 Complete amino acid sequence of human vitronectin deduced from cDNA. Similarity of cell attachment sites in vitronectin and fibronectin.
1709100 1991 Insulin binds to type V collagen with retention of mitogenic activity.
1706595 1991 Endogenous cleavage of the Arg-379-Ala-380 bond in vitronectin results in a distinct conformational change which 'buries' Ser-378, its site of phosphorylation by protein kinase A.
1704366 1991 Evidence that type 1 plasminogen activator inhibitor binds to the somatomedin B domain of vitronectin.
1696913 1990 The phosphorylation of the two-chain form of vitronectin by protein kinase A is heparin dependent.
1695900 1990 Alteration of serpin specificity by a protein cofactor. Vitronectin endows plasminogen activator inhibitor 1 with thrombin inhibitory properties.
1694173 1990 Purification and functional characterization of integrin alpha v beta 5. An adhesion receptor for vitronectin.
1632457 1992 Plasminogen activator inhibitor-1 deposition in the extracellular matrix of cultured human mesangial cells.
1377736 1992 Distribution of the extracellular matrix proteins tenascin, fibronectin, and vitronectin in fetal, infant, and adult human spleens.
1372588 1992 The human vitronectin (complement S-protein) gene maps to the centromeric region of 17q.
631332 1978 Primary structure of somatomedin B: a growth hormone-dependent serum factor with protease inhibiting activity.