Property Summary

NCBI Gene PubMed Count 26
PubMed Score 62.74
PubTator Score 86.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-03
astrocytoma -1.200 1.2e-02
atypical teratoid / rhabdoid tumor -1.200 9.9e-06
colon cancer -1.200 4.7e-03
ductal carcinoma in situ -1.100 1.7e-03
glioblastoma -1.100 2.3e-03
group 3 medulloblastoma -1.200 3.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.5e-03
invasive ductal carcinoma -1.100 1.3e-02
medulloblastoma, large-cell -1.500 4.6e-05
ovarian cancer -1.300 1.7e-04
pancreatic ductal adenocarcinoma liver m... -1.263 1.2e-03

Gene RIF (8)

AA Sequence

MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP      1 - 70
LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN     71 - 140
RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS    141 - 210
IIILLELAILGGLVYYKFFRSH                                                    211 - 232
//

Text Mined References (34)

PMID Year Title