Property Summary

NCBI Gene PubMed Count 40
PubMed Score 14.77
PubTator Score 10.75

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY      1 - 70
SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV     71 - 140
ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI    141 - 210
TFSVRRH                                                                   211 - 217
//

Text Mined References (43)

PMID Year Title