Property Summary

NCBI Gene PubMed Count 39
PubMed Score 13.75
PubTator Score 10.75

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (13)

Gene RIF (10)

PMID Text
25744365 The AA genotype of VTI1A (rs7086803) polymorphism had an increased risk of developing NSCLC compared with the GG genotype. Smoking lung cancer patients with the AA genotype of VTI1A gene (rs7086803) had a poor survival rate.
25105248 analysis of a new susceptibility locus for colorectal cancer in VTI1A [meta-analysis]
23677696 Data indicate that depletion of VAMP4, syntaxin 6, syntaxin 16, and Vti1a disrupted the Golgi ribbon structure.
22190034 HIV-1 gp41 is identified to have a physical interaction with vesicle transport through interaction with t-SNAREs homolog 1A (VTI1A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21892161 We found a colorectal carcinoma cell line harboring the fusion gene to be dependent on VTI1A-TCF7L2 for anchorage-independent growth using RNA interference-mediated knockdown.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19138172 The present results suggest that a SNARE complex containing VAMP7 and Vti1a defines a novel traffic pathway to the cell surface in both neuronal and non-neuronal cells.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY      1 - 70
SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV     71 - 140
ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI    141 - 210
TFSVRRH                                                                   211 - 217
//

Text Mined References (42)

PMID Year Title
26424050 2015 Genome-wide association study identifies multiple susceptibility loci for glioma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25771401 2015 A population study of binocular function.
25744365 2015 Single nucleotide polymorphisms in VTI1A gene contribute to the susceptibility of Chinese population to non-small cell lung cancer.
25105248 2014 Trans-ethnic genome-wide association study of colorectal cancer identifies a new susceptibility locus in VTI1A.
25002402 2014 Endosomal sorting of VAMP3 is regulated by PI4K2A.
24943349 2014 Whole genome sequencing reveals potential targets for therapy in patients with refractory KRAS mutated metastatic colorectal cancer.
24692499 2014 Associations between 25 lung cancer risk-related SNPs and polycyclic aromatic hydrocarbon-induced genetic damage in coke oven workers.
24608966 2014 High frequency of fusion transcripts involving TCF7L2 in colorectal cancer: novel fusion partner and splice variants.
24095276 2013 Syntaxin 13, a genetic modifier of mutant CHMP2B in frontotemporal dementia, is required for autophagosome maturation.
23932592 2013 Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6.
23865579 2013 Deficiency of the Cog8 subunit in normal and CDG-derived cells impairs the assembly of the COG and Golgi SNARE complexes.
23851226 2013 Monocytes and macrophages as biomarkers for the diagnosis of megalencephalic leukoencephalopathy with subcortical cysts.
23677696 2013 VAMP4 is required to maintain the ribbon structure of the Golgi apparatus.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
23143601 2012 Genome-wide association analysis identifies new lung cancer susceptibility loci in never-smoking women in Asia.
22958904 2012 VAMP1 mutation causes dominant hereditary spastic ataxia in Newfoundland families.
22645707 2012 The role of non-canonical SNAREs in synaptic vesicle recycling.
21892161 2011 Genomic sequencing of colorectal adenocarcinomas identifies a recurrent VTI1A-TCF7L2 fusion.
21807881 2011 The COG complex interacts directly with Syntaxin 6 and positively regulates endosome-to-TGN retrograde transport.
21554543 2011 Vesicular traffic in cell navigation.
21269460 2011 Initial characterization of the human central proteome.
21217069 2011 Dependence of Golgi apparatus integrity on nitric oxide in vascular cells: implications in pulmonary arterial hypertension.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19224922 2009 Differential effects of depletion of ARL1 and ARFRP1 on membrane trafficking between the trans-Golgi network and endosomes.
19138172 2009 A VAMP7/Vti1a SNARE complex distinguishes a non-conventional traffic route to the cell surface used by KChIP1 and Kv4 potassium channels.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18195106 2008 A syntaxin 10-SNARE complex distinguishes two distinct transport routes from endosomes to the trans-Golgi in human cells.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17337506 2007 Dysfunction of Golgi tethers, SNAREs, and SNAPs in monocrotaline-induced pulmonary hypertension.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15215310 2004 Participation of the syntaxin 5/Ykt6/GS28/GS15 SNARE complex in transport from the early/recycling endosome to the trans-Golgi network.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067063 2002 The SNAREs vti1a and vti1b have distinct localization and SNARE complex partners.
11839770 2002 Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform.
11101518 2000 A SNARE complex mediating fusion of late endosomes defines conserved properties of SNARE structure and function.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9446565 1998 A human homolog can functionally replace the yeast vesicle-associated SNARE Vti1p in two vesicle transport pathways.