Property Summary

NCBI Gene PubMed Count 75
PubMed Score 156.29
PubTator Score 108.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
medulloblastoma, large-cell 1.200 2.7e-04
primary pancreatic ductal adenocarcinoma -1.249 3.7e-02
non-small cell lung cancer 1.637 9.0e-08
intraductal papillary-mucinous adenoma (... -1.800 1.0e-02
intraductal papillary-mucinous carcinoma... -2.200 3.9e-04
interstitial cystitis -2.200 7.6e-05
Endometriosis -1.306 2.8e-02
Breast cancer -2.500 2.5e-04
ductal carcinoma in situ 2.000 4.3e-02
ovarian cancer 2.800 5.7e-04
pancreatic cancer -1.300 1.7e-02
psoriasis -1.200 1.8e-17

Gene RIF (68)

PMID Text
26773144 Data show that disrupted control of costimulation, evidenced by VTCN1 loss in both APCs and pancreatic islets, ultimately results in altered balance of control of immune responses.
26505457 study suggest that serum B7-H4 is an independent prognostic indicator for HCC and may be a promising biomarker for early diagnosis as well as disease prognosis of HCC.
26301886 Data indicate that the diagnostic efficiency of V-set domain containing T cell activation inhibitor 1 (sB7-H4) combined carcinoembryonic antigen (CEA) was superior to either sB7-H4 or CEA.
26211593 Low expression of VTCN1 inhibits the viability and metastasis of ovarian carcinoma.
26101181 In human amniotic fluid stem cells, the negative co-stimulatory molecule B7H4 regulates low immunogenicity, which can provide a modest inflammatory reaction microenvironment for wound repair.
26078947 B7-H4 expressed is elevated in colorectal cancer tissues than in the adjacent normal tissues. B7-H4 siRNA effectively inhibited the proliferation at 24 h and 48 h, arrested cell cycle at G0/G1, and suppressed cell invasion and migration.
25963168 B7-H4 levels in hepatocellular carcinoma patients were significantly higher than that in healthy controls. High B7-H4 levels were correlated with tumor size, tumor invasion, tumor differentiation and tumor-node metastasis stage.
25954746 our data suggest that the evaluation of B7-H4 expression in tissues and blood is a useful tool for predicting the progression of osteosarcoma and prognosis
25907449 In women who underwent elective cesarian section, a significant increase in sB7-H4 serum levels occurred postpartal, while in women who experienced spontaneous onset of labor, there were no differences between prepartal and postpartal levels.
25725157 Chromatin immunoprecipitation analysis demonstrated binding of hypoxia-inducible factor-1alpha (HIF-1alpha) to proximal hypoxia-response element (HRE) sites within the B7-H4 promoter in multiple myeloma cells and cancer cell lines.
25636447 In conclusion, measurement of sB7-H4 might be a useful diagnostic and prognostic value for malignant pleural effusion patients
25527357 B7-H4 expression by nonhematopoietic cells in the tumor microenvironment promotes antitumor immunity.
25446402 B7-H4 is overexpressed in human cervical cancers, and it is associated with low numbers of infiltrating CD8+T-lymphocytes and correspondingly low interferon-gamma production.
25437562 The crystal structure of the human B7x immunoglobulin variable (IgV) domain at 1.59 A resolution was determined and mapped the epitopes recognized by monoclonal antibodies.
25400757 Study indicates that B7-H4 has the potential to be an independent prognostic indicator for urothelial cell carcinoma.
25385143 Studied VTCN1 gene polymorphisms in susceptibility to Breast Cancer.
25260881 low expression of B7-H4 could serve as a candidate biomarker for predicting response to NACT and could provide favorable prognostic information in GC.
25053455 Over-expression of B7-H1 and B7-H4 has strong prognostic significance and promotes colorectal tumor tolerance.
24947047 High serum B7-H4 expression is associated with gastric cancer.
24848066 In type 1 diabetes, elevated blood sVTCN1 levels appeared early in the disease progression and correlated with the aggressive pace of disease
24658839 High B7-H4 expression is associated with uterine tumors.
24347572 VTCN1 rs10923223 and VTCN1 rs12046117 were associated with a remitting course of juvenile idiopathic arthritis.
24326367 Data suggest that B7-H4 pathway might play an important role in maintenance of beta-cell function, but its exact role remains to be explored.
24280570 patients who overexpressed B7H4 had worse prognosis than the ones who did not in pancreatic cancer
24125968 polymorphisms in the FGFR2 and B7H4 genes, which might be associated with breast cancer risk, have been evaluated for the first time in Turkish women with breast cancer.
23973734 role in the pathological changes of rheumatoid synovium in rheumatoid arthritis progression
23873101 High B7-H1 and B7-H4 expressions were closely correlated with poor prognosis in patients with colorectal cancer.
23803071 High B7-H4 expression is associated with thyroid cancer progression
23722540 our findings showed that cell surface expression of B7-H4 occurs only in tumors in vivo and that antibody binding of B7-H4 could restore antitumor T-cell responses.
23660627 Loss of B7-H4 function prevents tumor growth through many processes, including the induction of apoptosis and inhibition of the Erk1/2 signaling pathway indicating that B7-H4 is a cancer promoter and a potentially important therapeutic target.
23455497 B7x may enable metastasizing cancer cells to escape local antitumor immune responses through interactions with the innate and adaptive immune systems.
23318460 B7-H4 wild-type confers chemoresistance activity to RCC cell lines including Caki-1 and ACHN. Our study provides a new insight into the functional implication of B7-H4 in its subcellular localization
23147549 B7-H4 expression in malignant tumors is useful for clinical diagnosis, and may provide a novel molecular target for cancer treatment.[review]
23066977 The expression of B7-H4 molecule on immature BDCA-1(+) myeloid dendritic cells were significantly lower in umbilical cord blood of healthy neonates when compared with those cells in peripheral blood of healthy adults
22910694 A review of B7-H3 and B7-H4 immune molecules and the role their overexpression plays in ovarian cancer.
22613410 study concludes B7-H4 negatively regulates T cell-mediated antitumour immunity in nonsmall-cell lung cancer
22530960 The intensity of the suppressive profile of the cervical cancer microenvironment indicated by the presence of both RCAS1 and B7H4 on the front of the tumor and in the macrophages and fibroblasts infiltrating the cancer stroma
22323440 These results indicate a novel genetic association with the VTCN1 region in rheumatoid arthritis susceptibility.
22013483 paper summarizes the pertinent data on the inhibitory role of B7-H4 in antitumor immunity and its association with cancer progression and survival [review]
21748517 B7-H4 expression significantly correlated with tumor stage; the 5-year survival rate was significantly lower in patients with high B7-H4 expression than in those with low B7-H4 expression
21519829 High B7-H4 is associated with esophageal squamous cell carcinoma progression.
21478111 The expression of B7-H4 molecules on immature myeloid and lymphoid dendritic cells in cord blood of healthy neonates
21378130 Evidence of B7-H4 expression on melanoma cells as a mechanism controlling tumor immunity which is associated with patients' survival.
21190056 expression levels of B7-H4 in tumors indicated that B7-H4 may be involved in tumor formation and development.
21120594 intracellular B7-H4 appears to prevent Fas/FasL-mediated bile duct epithelial cell apoptosis during the progression of primary biliary cirrhosis
20872810 High B7-H4 mRNA copies were associated with gastric cancer progression.
20731031 B7-H4 was diffusely expressed in cytoplasm and/or membrane of the prostate cancer tissue; the expression was much higher than that in normal prostate tissue.
20725832 High B7-H4 is associated with gastric cancer.
20499308 Expression of B7-H4 had no effect on effectiveness of cytokine-induced killer cells adoptive immunotherapy in patients with gastric cancer.
20038306 The expression of OPN and B7-H4 increased in epithelial ovarian cancer.
19955922 B7-H4 directly promotes malignant transformation of ovarian cancer cell line.
19954668 Human bone marrow mesenchymal stem cells highly express B7H4, which plays an important role in the suppressive effects of HBMSC on T cell proliferation.
19903360 B7-H4 gene polymorphism may contribute to the sporadic breast cancer risk and prognosis in Chinese Han women.
19903360 Observational study of gene-disease association. (HuGE Navigator)
19788399 Novel role of B7-H4 molecule in the suppressive effect of hBMSCs on T-cell activation and proliferation.
19116933 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18676826 renal cell carcinoma patients are more likely to have detectable sB7x compared with controls and higher sB7x levels correlate with advanced tumor stage
18376314 B7-H4 was expressed more often in pancreatic ductal carcinoma than was p53.
17509674 B7-H4 is overexpressed in hyperplastic and malignant endometrial epithelium and is correlated with the T cell number associated with the tumor. B7-H4 overexpression may reflect a aggressive biologic potential and play a role in tumor immune surveillance.
17498784 B7-H4 expression was low in normal ovaries and in benign tumors while half of early stage and two-thirds of late stage cancers over-expressed B7-H4.
17051145 T-cell and epithelial cell crosstalk-associated B7-H4 induces T-cell activation and is a potential activator that promotes tubular lesion
16798883 patients with renal cell carcinoma (RCC) tumors expressing both B7-H4 and B7-H1 are at an even greater risk of death from RCC
16785496 B7-H4 in human antigen-presenting cells negatively regulates T cell responses.
16606666 B7-H4+ tumor macrophages constitute a novel suppressor cell population in ovarian cancer; B7-H4 expression represents a critical checkpoint in determining host responses to dysfunctional cytokines in ovarian cancer.
15878339 B7-H4 mRNA and protein are overexpressed in human serous ovarian cancers and breast cancers.
14568939 Tight regulation of B7-H4 expression at the translational level is observed in normal peripheral tissues and a potential role indicated in the evasion of tumor immunity.
12818166 Negative regulator of T cell activation. (B7S1)
12818165 May participate in negative regulation of cell-mediated immunity in peripheral tissues

AA Sequence

MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQ      1 - 70
WLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGN     71 - 140
ANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKV    141 - 210
VSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLM    211 - 280
LK                                                                        281 - 282
//

Text Mined References (79)

PMID Year Title
26773144 2016 Loss of Peripheral Protection in Pancreatic Islets by Proteolysis-Driven Impairment of VTCN1 (B7-H4) Presentation Is Associated with the Development of Autoimmune Diabetes.
26505457 2015 Circulating B7-H4 in serum predicts prognosis in patients with hepatocellular carcinoma.
26301886 2015 Evaluation of serum and pleural levels of soluble B7-H4 in lung cancer patients with pleural effusion.
26211593 2015 Effect of VTCN1 on progression and metastasis of ovarian carcinoma in vitro and vivo.
26101181 2015 Amniotic fluid stem cells provide considerable advantages in epidermal regeneration: B7H4 creates a moderate inflammation microenvironment to promote wound repair.
26078947 2015 Role of B7-H4 siRNA in Proliferation, Migration, and Invasion of LOVO Colorectal Carcinoma Cell Line.
25963168 2015 Diagnostic value of serum B7-H4 for hepatocellular carcinoma.
25954746 2015 B7-H4 expression is associated with tumor progression and prognosis in patients with osteosarcoma.
25907449 2015 Changes in the Blood Serum Levels of the Costimulatory Soluble B7-H4 Molecule in Pregnant Women During the Peripartal Phase.
25725157 2015 Cancer cell-associated cytoplasmic B7-H4 is induced by hypoxia through hypoxia-inducible factor-1? and promotes cancer cell proliferation.
25636447 2015 Prognostic value of soluble H7-B4 in pleural effusion associated with lung cancer.
25527357 2015 B7-H4 expression by nonhematopoietic cells in the tumor microenvironment promotes antitumor immunity.
25446402 2014 B7-H4 overexpression impairs the immune response of T cells in human cervical carcinomas.
25437562 2014 Structure and cancer immunotherapy of the B7 family member B7x.
25400757 2014 B7-H4 expression is correlated with tumor progression and clinical outcome in urothelial cell carcinoma.
25385143 2015 The Immune Regulator VTCN1 Gene Polymorphisms and Its Impact on Susceptibility to Breast Cancer.
25260881 2014 Impact of neoadjuvant chemotherapy on lymphocytes and co-inhibitory B7-H4 molecule in gastric cancer: low B7-H4 expression associates with favorable prognosis.
25053455 2014 B7-H1 and B7-H4 expression in colorectal carcinoma: correlation with tumor FOXP3(+) regulatory T-cell infiltration.
24947047 2014 Serum B7-H4 expression is a significant prognostic indicator for patients with gastric cancer.
24848066 2014 Nardilysin-dependent proteolysis of cell-associated VTCN1 (B7-H4) marks type 1 diabetes development.
24658839 2014 Mapping the immunosuppressive environment in uterine tumors: implications for immunotherapy.
24347572 2014 Genetic variation in VTCN1 (B7-H4) is associated with course of disease in juvenile idiopathic arthritis.
24326367 2014 B7-H4 expression in normal and diseased human islet ? cells.
24280570 B7H4, HSP27 and DJ-1 molecular markers as prognostic factors in pancreatic cancer.
24125968 An investigation of the effects of FGFR2 and B7-H4 polymorphisms in breast cancer.
23973734 Expression of co-stimulatory molecule B7-H4 in patients suffering from rheumatoid arthritis.
23873101 2014 T-cell infiltration and expressions of T lymphocyte co-inhibitory B7-H1 and B7-H4 molecules among colorectal cancer patients in northeast China's Heilongjiang province.
23803071 2013 B7-H4 expression is associated with cancer progression and predicts patient survival in human thyroid cancer.
23722540 2013 Novel recombinant human b7-h4 antibodies overcome tumoral immune escape to potentiate T-cell antitumor responses.
23660627 2013 B7-H4 enhances oncogenicity and inhibits apoptosis in pancreatic cancer cells.
23455497 2013 Host b7x promotes pulmonary metastasis of breast cancer.
23318460 2013 The costimulatory molecule B7-H4 promote tumor progression and cell proliferation through translocating into nucleus.
23147549 2012 Expression of costimulatory molecule B7-H4 in human malignant tumors.
23066977 2013 The expressions of co-stimulatory molecules are altered on putative antigen-presenting cells in cord blood.
22910694 2012 A review of B7-H3 and B7-H4 immune molecules and their role in ovarian cancer.
22613410 2012 Enhanced T cell immunity by B7-H4 downregulation in nonsmall-cell lung cancer cell lines.
22530960 2012 The immunohistochemical analysis of antigens such as RCAS1 and B7H4 in the cervical cancer nest and within the fibroblasts and macrophages infiltrating the cancer microenvironment.
22323440 2012 Novel genetic association of the VTCN1 region with rheumatoid arthritis.
22013483 2011 The inhibitory role of b7-h4 in antitumor immunity: association with cancer progression and survival.
21748517 2011 Clinical significance of the B7-H4 coregulatory molecule as a novel prognostic marker in gastric cancer.
21519829 2011 B7-H4 expression associates with cancer progression and predicts patient's survival in human esophageal squamous cell carcinoma.
21478111 2010 The expression of B7-H1 and B7-H4 molecules on immature myeloid and lymphoid dendritic cells in cord blood of healthy neonates.
21378130 2011 B7-h4 expression in human melanoma: its association with patients' survival and antitumor immune response.
21190056 2011 B7-H4 expression in various tumors determined using a novel developed monoclonal antibody.
21120594 2011 Intracellular B7-H4 suppresses bile duct epithelial cell apoptosis in human primary biliary cirrhosis.
20872810 2010 Expression of B7-H4 in blood of patients with gastric cancer predicts tumor progression and prognosis.
20731031 2010 [Expression of B7-H4 in prostate cancer and its clinical significance].
20725832 2010 Tumor expression of B7-H4 predicts poor survival of patients suffering from gastric cancer.
20499308 2010 [Influence of co-stimulatory molecules B7-H4 expression on the prognosis of patients with gastric cancer treated with cytokine-induced killer cells adoptive immunotherapy].
20038306 2010 [Expressions of osteopontin and B7-H4 in epithelial ovarian neoplasm and their significance].
19955922 2009 B7-H4 expression promotes tumorigenesis in ovarian cancer.
19954668 2009 [The effects of B7H4 on human bone marrow mesenchymal stem cell inhibiting proliferation of PHA activated T cells].
19903360 2009 B7-H4 gene polymorphisms are associated with sporadic breast cancer in a Chinese Han population.
19788399 2010 The negative co-signaling molecule b7-h4 is expressed by human bone marrow-derived mesenchymal stem cells and mediates its T-cell modulatory activity.
19116933 2009 Identification of a novel susceptibility locus for juvenile idiopathic arthritis by genome-wide association analysis.
18676826 2008 Serum-soluble B7x is elevated in renal cell carcinoma patients and is associated with advanced stage.
18376314 2008 Detection of B7-H4 and p53 in pancreatic cancer: potential role as a cytological diagnostic adjunct.
17875732 2007 Relationship between B7-H4, regulatory T cells, and patient outcome in human ovarian carcinoma.
17509674 2007 B7-H4 (DD-O110) is overexpressed in high risk uterine endometrioid adenocarcinomas and inversely correlated with tumor T-cell infiltration.
17498784 2007 B7-H4 is over-expressed in early-stage ovarian cancer and is independent of CA125 expression.
17051145 2006 Expression of the novel co-stimulatory molecule B7-H4 by renal tubular epithelial cells.
16798883 2006 B7-H4 expression in renal cell carcinoma and tumor vasculature: associations with cancer progression and survival.
16785496 2006 Cutting edge: induction of B7-H4 on APCs through IL-10: novel suppressive mode for regulatory T cells.
16782226 2006 B7-H3 and B7-H4 expression in non-small-cell lung cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16606666 2006 B7-H4 expression identifies a novel suppressive macrophage population in human ovarian carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15878339 2005 The immunomodulatory protein B7-H4 is overexpressed in breast and ovarian cancers and promotes epithelial cell transformation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14568939 2003 Genomic organization and expression analysis of B7-H4, an immune inhibitory molecule of the B7 family.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12920180 2003 B7x: a widely expressed B7 family member that inhibits T cell activation.
12818166 2003 B7S1, a novel B7 family member that negatively regulates T cell activation.
12818165 2003 B7-H4, a molecule of the B7 family, negatively regulates T cell immunity.
12796776 2003 BTLA is a lymphocyte inhibitory receptor with similarities to CTLA-4 and PD-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.