Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.53
PubTator Score 18.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.200 5.1e-14
oligodendroglioma -1.100 6.9e-04
atypical teratoid/rhabdoid tumor -1.200 5.6e-08
glioblastoma -1.200 6.3e-04
medulloblastoma, large-cell -1.200 1.7e-04
primary Sjogren syndrome 1.300 4.6e-04
aldosterone-producing adenoma -1.015 2.5e-02
ovarian cancer -1.100 2.7e-06

 GO Function (1)

Gene RIF (6)

PMID Text
25657007 Crystal structures of three molecular complexes reveal that IST1 binds to the MIT domains of VPS4 and LIP5.
25637630 ESCRT-III protein CHMP5 inhibits LIP5-mediated VPS4 activation by inducing a moderate conformational change within LIP5.
25164817 Vps4 stimulatory element of the cofactor Vta1 contacts the ATPase Vps4 alpha7 and alpha9 subunits to stimulate ATP hydrolysis.
23105106 the tandem MIT domain of LIP5 binds different types of ESCRT-III proteins, promoting assembly of active VPS4 enzymes on the polymeric ESCRT-III substrate.
21060863 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20358264 LIP5 protein expression in a mouse tissue panel and various rodent and human tissues were studied.

AA Sequence

MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL      1 - 70
KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK     71 - 140
HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT    141 - 210
GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG    211 - 280
SALQYEDVSTAVQNLQKALKLLTTGRE                                               281 - 307
//

Text Mined References (36)

PMID Year Title
25657007 2015 Distinct mechanisms of recognizing endosomal sorting complex required for transport III (ESCRT-III) protein IST1 by different microtubule interacting and trafficking (MIT) domains.
25637630 2015 A novel mechanism of regulating the ATPase VPS4 by its cofactor LIP5 and the endosomal sorting complex required for transport (ESCRT)-III protein CHMP5.
25164817 2014 Vps4 stimulatory element of the cofactor Vta1 contacts the ATPase Vps4 ?7 and ?9 to stimulate ATP hydrolysis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21543490 2011 Mechanism of inhibition of retrovirus release from cells by interferon-induced gene ISG15.
21269460 2011 Initial characterization of the human central proteome.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20358264 2010 The lysosomal trafficking regulator interacting protein-5 localizes mainly in epithelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19129480 2009 Essential role of hIST1 in cytokinesis.
19129479 2009 Biochemical analyses of human IST1 and its function in cytokinesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18385515 2008 Novel interactions of ESCRT-III with LIP5 and VPS4 and their implications for ESCRT-III disassembly.
17261583 2007 Targeting of AMSH to endosomes is required for epidermal growth factor receptor degradation.
16193069 2005 Structural and mechanistic studies of VPS4 proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15644320 2005 The role of LIP5 and CHMP5 in multivesicular body formation and HIV-1 budding in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15173323 2004 Mammalian class E Vps proteins, SBP1 and mVps2/CHMP2A, interact with and regulate the function of an AAA-ATPase SKD1/Vps4B.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11489251 2001 Identification of dopamine responsive mRNAs in glial cells by suppression subtractive hybridization.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.